DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11668 and CG34436

Sequence 1:NP_650254.1 Gene:CG11668 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001097954.1 Gene:CG34436 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster

Alignment Length:267 Identity:55/268 (21%)
Similarity:107/268 (40%) Gaps:59/268 (22%)


  Fly   145 QNLLVGGRLTQE--NEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFAITAAHCAS 207
            ||.....||:.:  ...|:|..:..|::|                 |..|:|...|.||:|.|  
  Fly    25 QNCAEVSRLSNDIIFSRPWMALVLLPNKT-----------------CSGALIHKYFVITSASC-- 70

  Fly   208 VGGESPSVALIGGVELN-----SGRGQLIEIKRISQHPHFDAETLTNDLAVVKLAR----RSHMP 263
            |..:..::..:|.:.:.     |.......::....|..::.....:|:|:::|..    ::|:.
  Fly    71 VFNQERAIVRLGQLSIKQEHIVSYSSDDYHVQSAYIHRFYEKSNFEHDIALLELQNDVLYKAHIR 135

  Fly   264 VACLWNQESLPERPL----TALGYG-QTKFAGPHSSNLLQIMLYHLNFQQCQRYLHNYDKLANGL 323
            ..|||..:|..:..:    ....:| ..|:..|.:..   ..:.|::..:|:.....|.:     
  Fly   136 PICLWLDKSDIDTQMFKRYETFRWGIDEKYILPAAKT---SKIKHISQVKCENAFKLYPQ----- 192

  Fly   324 GSGQMCAGDYSGNMDTCQGDSGGPLLLHQHMRHH---RHTIPYVVGITSFGGACASGQPGVYVRI 385
             :..:||| |. |...|. ::|.||.  :.:|::   |:|:   .||.|:|    ..:..:|..:
  Fly   193 -NSHICAG-YK-NKSKCV-ETGSPLF--KKIRYYTKIRYTL---FGIQSYG----ESRTCLYTDV 244

  Fly   386 AHYIQWI 392
            ..||.||
  Fly   245 TKYIDWI 251

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 53/264 (20%)
Tryp_SPc 149..392 CDD:214473 52/262 (20%)
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 51/253 (20%)
Tryp_SPc 40..251 CDD:214473 50/251 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C47710
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24258
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.