DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11668 and CG34437

Sequence 1:NP_650254.1 Gene:CG11668 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001097955.1 Gene:CG34437 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster

Alignment Length:252 Identity:59/253 (23%)
Similarity:104/253 (41%) Gaps:65/253 (26%)


  Fly   158 EHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFAITAAHCASVGGESPSVALIG--- 219
            |.|:|..:..|::                 ||...:|..::.||.|.|  |..:|.|...:|   
  Fly    39 ETPWMAFIASPTK-----------------NCSGTLINKQYVITTASC--VFDQSESTVFLGRFD 84

  Fly   220 GVELNSGRGQLIEIKRISQHPHFDAETLTNDLAVVKL-----ARRSHMPVACLWNQESLPERPLT 279
            .:..|..|.....::.:..|..::.:|..:|:|::.|     .:.|..|: |:|..|      :|
  Fly    85 NIPQNRNRYVKHSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPI-CIWLGE------IT 142

  Fly   280 ALGYGQTKFAGPHSSNLLQIMLYH-------LNFQQCQRYLHNYDKLANGLGSGQMCAGDYSGNM 337
            .|.:.::...|     |.:.|::.       |..::|:      |.....|...|:|||..:||:
  Fly   143 NLNHLESNRWG-----LSEKMIFQRINTVKILKIKKCR------DSFGITLKKSQICAGFQNGNI 196

  Fly   338 DTCQGDSGGPLLLHQHMRHHRHTIPYVVGITSFGGA--CASGQPGVYVRIAHYIQWI 392
            .|..|.|     |.:.:.:.......::||.|:|.:  |      :|.:|||||.||
  Fly   197 CTETGSS-----LVKQIHYSGKLWNTLIGIQSYGVSERC------IYNKIAHYIDWI 242

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 59/253 (23%)
Tryp_SPc 149..392 CDD:214473 58/251 (23%)
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 58/251 (23%)
Tryp_SPc 39..242 CDD:304450 58/251 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C47705
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24258
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.