DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11668 and PROC

Sequence 1:NP_650254.1 Gene:CG11668 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_024308770.1 Gene:PROC HGNCID:9451 Length:576 Species:Homo sapiens

Alignment Length:376 Identity:96/377 (25%)
Similarity:159/377 (42%) Gaps:87/377 (23%)


  Fly    43 NCQAHDRPLIGKCVRYVDCISAMQAVPRVTPLLCPSSWPNQLVCCPHGGYLLPP------PSISK 101
            ||...:    |.|..|  |:..:             .| .:..|.|  ||.|..      |::  
Human   254 NCSLDN----GGCTHY--CLEEV-------------GW-RRCSCAP--GYKLGDDLLQCHPAV-- 294

  Fly   102 SEQACANAYPRAHHKRRRRRRNTNPKLDQVELVEPIIQKHNQSQNLLVGGRLTQENEHPYMCALG 166
             :..|...:.|...||...:|:|.   ||.:.|:|          .|:.|::|:..:.|:...| 
Human   295 -KFPCGRPWKRMEKKRSHLKRDTE---DQEDQVDP----------RLIDGKMTRRGDSPWQVVL- 344

  Fly   167 WPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFAITAAHCASVGGESPSVAL-IGGVELNS-GRGQ 229
                        ..||::..  ||..:|.|.:.:|||||..   ||..:.: :|..:|.. .:.:
Human   345 ------------LDSKKKLA--CGAVLIHPSWVLTAAHCMD---ESKKLLVRLGEYDLRRWEKWE 392

  Fly   230 L-IEIKRISQHPHFDAETLTNDLAVVKLAR-----RSHMPVACLWNQESLPERPLTALGYGQTKF 288
            | ::||.:..||::...|..||:|::.||:     ::.:|: || ....|.||.|...|. :|..
Human   393 LDLDIKEVFVHPNYSKSTTDNDIALLHLAQPATLSQTIVPI-CL-PDSGLAERELNQAGQ-ETLV 454

  Fly   289 A--GPHSSNLLQI---MLYHLNFQQCQRYLHN--YDKLANGLGSGQMCAGDYSGNMDTCQGDSGG 346
            .  |.|||...:.   ..:.|||.:.....||  .:.::|.:....:|||......|.|:|||||
Human   455 TGWGYHSSREKEAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGG 519

  Fly   347 PLLLHQHMRHHRHTIPYVVGITSFGGACA-SGQPGVYVRIAHYIQWIEQQV 396
            |::...|...      ::||:.|:|..|. ....|||.:::.|:.||...:
Human   520 PMVASFHGTW------FLVGLVSWGEGCGLLHNYGVYTKVSRYLDWIHGHI 564

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 72/262 (27%)
Tryp_SPc 149..392 CDD:214473 71/259 (27%)
PROCXP_024308770.1 GLA 117..168 CDD:214503
EGF_CA 182..213 CDD:238011
FXa_inhibition 255..290 CDD:317114 11/57 (19%)
Tryp_SPc 328..563 CDD:238113 72/262 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.