DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11668 and CG11842

Sequence 1:NP_650254.1 Gene:CG11668 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster

Alignment Length:285 Identity:81/286 (28%)
Similarity:135/286 (47%) Gaps:37/286 (13%)


  Fly   128 LDQVELVEPIIQKHNQSQNLLVGGRLTQENEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCA 192
            ::...::...:.|......|::||......|.|:...||           |........:.||..
  Fly    53 IENAPIIYKTLDKCTSYAPLIIGGGPAVPKEFPHAARLG-----------HKDENGEVEWFCGGT 106

  Fly   193 MIAPRFAITAAHCASVGGESPSVALIGGVELNSGRGQL----IEIKRISQHPHFDAETLTNDLAV 253
            :|:.|..:|||||......|.::|.:|.:|.::.....    .::|..:.||.|....:.||::|
  Fly   107 LISDRHVLTAAHCHYSPQGSVNIARLGDLEFDTNNDDADPEDFDVKDFTAHPEFSYPAIYNDISV 171

  Fly   254 VKLARRSHMPV--------ACLWNQESLPERPLTALGYGQTKFAGPHSSN--LLQIMLYHLNFQQ 308
            |:|:|    ||        |||...:........|:|:||.:.. |.:.|  |.::.||:.. .:
  Fly   172 VRLSR----PVTFNDYKHPACLPFDDGRLGTSFIAIGWGQLEIV-PRTENKKLQKVKLYNYG-TR 230

  Fly   309 CQRYLHNYDKLANGL-GSGQMCAGDYSGNMDTCQGDSGGPLLLHQHMRHHRHTIPYVVGITSFGG 372
            |:......|:|..|. .:.|:|.|. :.:.|||.||||||:|:: ||.:  ..:.:|:||||.|.
  Fly   231 CRITADRNDELPEGYNATTQLCIGS-NEHKDTCNGDSGGPVLIY-HMDY--PCMYHVMGITSIGV 291

  Fly   373 ACASGQ-PGVYVRIAHYIQWIEQQV 396
            ||.:.. |.:|.|:..|:.||:||:
  Fly   292 ACDTPDLPAMYTRVHFYLDWIKQQL 316

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 78/262 (30%)
Tryp_SPc 149..392 CDD:214473 76/259 (29%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 78/263 (30%)
Tryp_SPc 73..312 CDD:214473 76/260 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.