DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11668 and CG7432

Sequence 1:NP_650254.1 Gene:CG11668 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_650825.2 Gene:CG7432 FlyBaseID:FBgn0038727 Length:721 Species:Drosophila melanogaster

Alignment Length:410 Identity:107/411 (26%)
Similarity:158/411 (38%) Gaps:107/411 (26%)


  Fly    53 GKCVRYVDCISAMQAVPRVTPLLCPSSWPNQLVCCPHGGYLLPPPSISKSEQACANAYP------ 111
            |:|.....|.:.:..:..:...||..|.....||||          ||.|........|      
  Fly   343 GRCEDLSSCPALLLNLSSLRESLCFKSLYVPGVCCP----------ISSSSTVLTTQKPLRLTTR 397

  Fly   112 --------RAHH--KRRRRRRNTNPK----------------------------LDQV--ELVEP 136
                    :|..  |:...|..|.|.                            ||::  .:|:|
  Fly   398 PTTTTSTTKATQPTKKSTVRPTTRPTSGLVLIPQKKPPTTTTTTTTEVPLEPEGLDEIGNNIVDP 462

  Fly   137 -IIQKHNQSQNLLVGGRLTQENEHPYMCA--LGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRF 198
             ...:...|...:|||......:.|:|.|  |..|.||..|              ||.::|..::
  Fly   463 DECGQQEYSTGRIVGGVEAPNGQWPWMAAIFLHGPKRTEFW--------------CGGSLIGTKY 513

  Fly   199 AITAAHCASVGGESPSVA-----LIGGVELNSGRGQ----LIEIKRISQHPHFDAETLTNDLAVV 254
            .:|||||.....:.|..|     .:|.::|::....    ...:|.:..|..|......||:|::
  Fly   514 ILTAAHCTRDSRQKPFAARQFTVRLGDIDLSTDAEPSDPVTFAVKEVRTHERFSRIGFYNDIAIL 578

  Fly   255 ---KLARRSH--MPVACLWN------QESLPERPLTALGYGQTKFAGPHSSNLLQIMLYHLNFQQ 308
               |..|:|.  :|| ||..      :|.||.|..|.:|:|.|.:.|..|::..|..|.....:.
  Fly   579 VLDKPVRKSKYVIPV-CLPKGIRMPPKERLPGRRATVVGWGTTYYGGKESTSQRQAELPIWRNED 642

  Fly   309 CQRYLHNYDKLANGLGSGQMCAGDYSGNMDTCQGDSGGPLLLHQHMRHHRHTIPYVVGITSFGGA 373
            |.|   :|.:..|   ...:|||...|.:|.|||||||||:    ||:..|.:.  :|:.|||..
  Fly   643 CDR---SYFQPIN---ENFICAGYSDGGVDACQGDSGGPLM----MRYDSHWVQ--LGVVSFGNK 695

  Fly   374 CAS-GQPGVYVRIAHYIQWI 392
            |.. |.||||.|:..|:.||
  Fly   696 CGEPGYPGVYTRVTEYLDWI 715

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 83/268 (31%)
Tryp_SPc 149..392 CDD:214473 82/266 (31%)
CG7432NP_650825.2 CLIP 335..378 CDD:197829 9/35 (26%)
Tryp_SPc 474..715 CDD:214473 82/268 (31%)
Tryp_SPc 475..718 CDD:238113 83/269 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24258
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.