DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11668 and CG9616

Sequence 1:NP_650254.1 Gene:CG11668 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_650347.2 Gene:CG9616 FlyBaseID:FBgn0038214 Length:155 Species:Drosophila melanogaster

Alignment Length:47 Identity:11/48 (23%)
Similarity:22/48 (46%) Gaps:5/48 (10%)


  Fly    58 YVDCISAMQAVPRVTPLLCPSSWPNQLVCCPHGGYLLPPPSISKSEQ 104
            :|:.::...|:|::|.|     :.|..:.|.:..|..|...|:...|
  Fly    99 FVEFLNITNALPKLTSL-----YLNDQLLCSNEEYPFPKTRITLRHQ 140

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113
Tryp_SPc 149..392 CDD:214473
CG9616NP_650347.2 GD_N 24..128 CDD:292649 7/34 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C47785
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.