DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11668 and CG9631

Sequence 1:NP_650254.1 Gene:CG11668 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_650345.1 Gene:CG9631 FlyBaseID:FBgn0027563 Length:439 Species:Drosophila melanogaster

Alignment Length:369 Identity:88/370 (24%)
Similarity:142/370 (38%) Gaps:102/370 (28%)


  Fly    82 NQLVCCPHGGYLLPP------PSISKSEQACANAYPRAHHKRRRRRRNT------------NPKL 128
            |..|.|.:..|..|.      .|:|.|......:.||...::||...:|            .|::
  Fly   117 NGEVLCQNEEYDAPSSTMTRRQSMSTSTPISQKSAPREIVRQRRPPPSTPSNDPNPFLPSIMPRI 181

  Fly   129 DQ------VELVEPIIQKHNQSQNLLVGGRLTQENEHPYMCALGWPSRTNRWIHEH-GSSKRRYT 186
            |.      ||...|          |.:||.|....::|::.||          :|. |::    |
  Fly   182 DSDFEECGVEGFSP----------LQIGGDLVTRGQYPWLAAL----------YEGVGTA----T 222

  Fly   187 FNCGCAMIAPRFAITAAHCASVGGESPSV--ALIGGVELN---SGRGQLIEIKRI------SQHP 240
            :.|..::|:.|..||||||  :.|:|.|.  ..:|..:.|   .....|:.:..:      ..:|
  Fly   223 YKCVVSVISKRTVITAAHC--IYGKSASQLWVYLGRHDRNENPENGASLVSVTSVLTPSAYEGNP 285

  Fly   241 HFDAE----TLTNDLAVVKLARRSHMPVACLWNQE-SLPER-----PLTALGYG----QTKFAGP 291
            ..||:    .||:.:...|..|    |: |||... .||..     .:...||.    :|:|...
  Fly   286 VPDADVGLLVLTSPMVYTKYIR----PL-CLWGSNMGLPPNEGDTGAVAGWGYDRSAQKTRFPKT 345

  Fly   292 HSSNLLQIMLYHLNFQQCQRYLHNYDKLANGLGSGQMCAGDYSGNMDTCQGDSGGPLLLHQHMRH 356
            .|..|:.       ..||   |....:..:.:....:|||: |.:...|.||||..|::   :|:
  Fly   346 VSVRLVP-------RDQC---LKEMKRAEDFITRRTVCAGN-SESHGPCFGDSGSALIV---LRN 396

  Fly   357 HRHTIPYVVGITSF----GGACASGQPGVYVRIAHYIQWIEQQV 396
            :|.   ||.|:.|.    |..|...:..:|..:|.:|.|:.|.:
  Fly   397 NRW---YVRGVVSLSPRHGEICDLSKYVIYCDVARHIDWVRQNM 437

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 69/276 (25%)
Tryp_SPc 149..392 CDD:214473 68/273 (25%)
CG9631NP_650345.1 GD_N 26..127 CDD:292649 3/10 (30%)
Tryp_SPc 198..436 CDD:238113 69/276 (25%)
Tryp_SPc 198..433 CDD:214473 68/273 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C47949
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24258
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.