DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11668 and CG11670

Sequence 1:NP_650254.1 Gene:CG11668 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001097767.2 Gene:CG11670 FlyBaseID:FBgn0038114 Length:404 Species:Drosophila melanogaster

Alignment Length:325 Identity:105/326 (32%)
Similarity:156/326 (48%) Gaps:56/326 (17%)


  Fly    95 PPPSISKSEQACANAYPRAHHKR-RRRRRNTNPKLDQVELVEPIIQKHNQSQNL---LVGGRLTQ 155
            |||:               ||:. .....||..|:|...     ..|..::::|   ..|..:..
  Fly   106 PPPN---------------HHRNFHNIFLNTESKVDGEN-----YNKTAETEDLHDDFNGRSIVA 150

  Fly   156 ENEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFAITAAHCASVGGESPSVALIGG 220
            ..::|:|.|||:.:..    ||       ..:.||.::|:..|.:|||||.:..|.||.:..||.
  Fly   151 PGQYPHMAALGFRNEN----HE-------IDYKCGGSLISEEFVLTAAHCLTTHGTSPDIVKIGD 204

  Fly   221 VELNSGRGQLI-EIKRISQ---HPHFDAETLTNDLAVVKLARRSHMPV--------ACLWNQESL 273
            ::|......:. :.:|::|   ||.::|....:|:.:::|.|    ||        ..||....:
  Fly   205 IKLKEWELNVAPQRRRVAQIYLHPLYNASLNYHDIGLIQLNR----PVEYTWFVRPVRLWPMNDI 265

  Fly   274 PERPLTALGYGQTKFAGPHSSNLLQIMLYHLNFQQCQRYLHNYDKLANGLGSGQMCAGDYSGNMD 338
            |...|..:|||.|.||.|.::.|.::.|..:..:||...|...:...:||.:.|:||.||..|.|
  Fly   266 PYGKLHTMGYGSTGFAQPQTNILTELDLSVVPIEQCNSSLPADEGSPHGLLTSQICAHDYEKNRD 330

  Fly   339 TCQGDSGGPLLLHQHMRHHRHTIP-----YVVGITSFGGACASGQPGVYVRIAHYIQWIEQQVWP 398
            ||||||||||.|:...|..|||..     |:|||||:|..|.|..||||.|::.||.||...|||
  Fly   331 TCQGDSGGPLQLNLERRRRRHTSRKHYRYYLVGITSYGAYCRSELPGVYTRVSSYIDWIASIVWP 395

  Fly   399  398
              Fly   396  395

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 91/263 (35%)
Tryp_SPc 149..392 CDD:214473 90/260 (35%)
CG11670NP_001097767.2 Tryp_SPc 145..392 CDD:238113 91/262 (35%)
Tryp_SPc 145..389 CDD:214473 90/259 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131167760
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24258
RoundUp 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.