DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11668 and CG10041

Sequence 1:NP_650254.1 Gene:CG11668 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_650177.2 Gene:CG10041 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster

Alignment Length:266 Identity:57/267 (21%)
Similarity:100/267 (37%) Gaps:77/267 (29%)


  Fly   159 HPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFAITAAHCASVGGESPSVALIGGVE- 222
            :||:.::|            .:.|..|...|...:::..|.::||||... ..:..:.:.||.: 
  Fly    50 YPYIVSIG------------ENLKGYYKHLCVGVILSNEFVLSAAHCIQT-NPTKQLYVAGGADS 101

  Fly   223 LNSGRGQLIEIKRISQHPHFDAETL-TNDLAVVKLARRSHMPVACLWNQESLPERPLTALGYGQT 286
            |||.:.....:.....||.|  ..| .||:||:::                .|:.||..:.:...
  Fly   102 LNSRKQTRFFVVERRWHPQF--RVLGGNDIAVLRI----------------YPKFPLDDVRFRSI 148

  Fly   287 KFAG-PHSSN-------------------LLQIMLYHLNFQQCQR-----YLHNYDKLANGLGSG 326
            .||| |...:                   |.::....:...:||:     :|...|         
  Fly   149 NFAGKPQRDSGTQASLVGWGRVGVGKIRKLQEMPFLTMENDECQQSHRFVFLKPLD--------- 204

  Fly   327 QMCAGDYSGNMDTCQGDSGGPLLLHQHMRHHRHTIPYVVGITSFG-GACASGQPGVYVRIAHYIQ 390
             :||....|....|.||||.||:   ::...:     :.|:.|:| .||...:|..:.||..|..
  Fly   205 -ICAMHLKGPRGPCDGDSGAPLM---NVAKEK-----LYGLLSYGRKACTPLKPYAFTRINAYSS 260

  Fly   391 WIEQQV 396
            ||::.:
  Fly   261 WIQESM 266

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 57/264 (22%)
Tryp_SPc 149..392 CDD:214473 56/261 (21%)
CG10041NP_650177.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48286
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24258
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.