DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11668 and CG12951

Sequence 1:NP_650254.1 Gene:CG11668 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster

Alignment Length:263 Identity:66/264 (25%)
Similarity:106/264 (40%) Gaps:73/264 (28%)


  Fly   172 NRWIHEHGSSKRRYTF-----------NCGCAMIAPRFAITAAHCASVGGESPSVALIGGVELNS 225
            :|.::...||..:|.|           :||.::|:..|.:|||||.: |..:.::::..||...|
  Fly    28 SRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTN-GRPADTLSIQFGVTNIS 91

  Fly   226 GRG-QLIEIKRISQHPHFD-AETLTNDLAVVKLARR------SHMPVACLWNQESLPERPLTA-- 280
            ..| .::.||:|.||..|| .....||::::.:...      |..||          |.|..|  
  Fly    92 AMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPV----------ELPALAFA 146

  Fly   281 ------------LGYGQTKFAGPHSSNLLQIMLYHLNFQQCQRYLHNYDKLANGLGSGQ------ 327
                        :|:|.....|.....|.::.|...:.::|.. .||          ||      
  Fly   147 VPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTS-RHN----------GQTDPKYH 200

  Fly   328 MCAGDYSGNMDTCQGDSGGPLLLHQHMRHHRHTIPYVVGITSFG--GACASGQPGVYVRIAHYIQ 390
            :|.|...|....|.|||||||:.:...          |||.|:.  ....:..||||.:::.|:.
  Fly   201 ICGGVDEGGKGQCSGDSGGPLIYNGQQ----------VGIVSWSIKPCTVAPYPGVYCKVSQYVD 255

  Fly   391 WIE 393
            ||:
  Fly   256 WIK 258

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 66/264 (25%)
Tryp_SPc 149..392 CDD:214473 65/261 (25%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 65/260 (25%)
Tryp_SPc 30..260 CDD:238113 65/262 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48291
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.