DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11668 and CG14642

Sequence 1:NP_650254.1 Gene:CG11668 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001246901.1 Gene:CG14642 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster

Alignment Length:341 Identity:110/342 (32%)
Similarity:164/342 (48%) Gaps:51/342 (15%)


  Fly    77 PSSWPNQLVCCPHGGYLLPPPSISKSEQACANAYPRAHHKR-RRRRRNTNPKLDQ-VELVEP--- 136
            |...|.|....|..|...|||             |....|: .::||....|..: ||.:.|   
  Fly    82 PKPKPRQYPPPPMPGQPFPPP-------------PGGFKKKENKQRRLCEQKYSEYVERIFPNDT 133

  Fly   137 -IIQKHNQSQNLLVGGR-LTQENEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFA 199
             :....|.:.   ..|| |.:..|:|:|.|:|:.           |.:.:..:.||.::|:.||.
  Fly   134 AVAADANDAD---FDGRVLARPGEYPHMAAVGFE-----------SDRGQVDYKCGGSLISERFV 184

  Fly   200 ITAAHCASVGGESPSVALIGGVELNSGR----GQLIEIKRISQHPHFDAETLTNDLAVVKLARRS 260
            :|||||.|:....|....||.::|.|.:    .||:.|:::..||::..:...:|:|::||.:..
  Fly   185 LTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEV 249

  Fly   261 HM-----PVACLWNQESLPERPLT---ALGYGQTKFAGPHSSNLLQIMLYHLNFQQCQRYLHNYD 317
            .:     ||. ||   ..||.|.|   |:|||.|.||.|.::.|..:.|..:...:|...|....
  Fly   250 ELTEYVRPVR-LW---VFPELPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLA 310

  Fly   318 KLANGLGSGQMCAGDYSGNMDTCQGDSGGPLLLHQHMRHHRHTIPY-VVGITSFGGACASGQPGV 381
            :..:|:...|:||.||..|.|||||||||||.|:...|...|.|.| ::||||:|..|.|..|.|
  Fly   311 ETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCRSSYPSV 375

  Fly   382 YVRIAHYIQWIEQQVW 397
            |.|::.::.|||..||
  Fly   376 YTRVSSFLDWIELTVW 391

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 91/260 (35%)
Tryp_SPc 149..392 CDD:214473 89/257 (35%)
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 90/256 (35%)
Tryp_SPc 146..386 CDD:214473 89/255 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131167785
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24258
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.