DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11668 and CG9372

Sequence 1:NP_650254.1 Gene:CG11668 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_649132.1 Gene:CG9372 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster

Alignment Length:379 Identity:98/380 (26%)
Similarity:148/380 (39%) Gaps:87/380 (23%)


  Fly    41 YGNCQAHDRPL--IGKCVRYVDC--ISAMQAVPRVTPLLCPSSWPNQLVCCPHGGYLLPPPSISK 101
            ||.|..   ||  .|:|...:.|  ......|.|:...||.....:..:||              
  Fly    84 YGACST---PLGESGRCRHIIYCRMPELKNDVWRLVSQLCIIEKSSIGICC-------------- 131

  Fly   102 SEQACANAYPRAHHKRRRRRRNTNPK-LDQVELVEP-IIQKHNQ------SQNL--LVGGRLTQE 156
            ::|:.:|.:              :|: :...:..|| |:.|..|      |:..  |.|||..:.
  Fly   132 TDQSTSNRF--------------SPQVVTSADGDEPRIVNKPEQRGCGITSRQFPRLTGGRPAEP 182

  Fly   157 NEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFAITAAHCASVGGESPSVALIGGV 221
            :|.|:|.||........|              ||..:|..|..:|||||.....:......:|..
  Fly   183 DEWPWMAALLQEGLPFVW--------------CGGVLITDRHVLTAAHCIYKKNKEDIFVRLGEY 233

  Fly   222 E---LNSGRGQLIEIKRISQHPHFDAETLTNDLAVVKLARRSHM-----PVACLWNQESLPERPL 278
            .   ||..|.:...|..:..|..::.:...||:|:|::.|.:..     ||......|...:|..
  Fly   234 NTHMLNETRARDFRIANMVLHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCMPPVNEDWSDRNA 298

  Fly   279 TALGYGQTKFAGPHSSNLLQIMLYHLNFQQCQRYLHNYDKLANGLGSGQMCAGDYSGNMDTCQGD 343
            ...|:|..||.||||:.|:::.|.......|:      ......:....||||...|..|:||||
  Fly   299 IVTGWGTQKFGGPHSNILMEVNLPVWKQSDCR------SSFVQHVPDTAMCAGFPEGGQDSCQGD 357

  Fly   344 SGGPLLLHQHMRHHRHTIP----YVVGITSFGGACAS-GQPGVYVRIAHYIQWI 392
            ||||||:.         :|    ..:||.|:|..|.. |:||:|.|:..|:.||
  Fly   358 SGGPLLVQ---------LPNQRWVTIGIVSWGVGCGQRGRPGIYTRVDRYLDWI 402

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 74/258 (29%)
Tryp_SPc 149..392 CDD:214473 73/256 (29%)
CG9372NP_649132.1 CLIP 87..132 CDD:197829 12/62 (19%)
Tryp_SPc 173..402 CDD:214473 74/258 (29%)
Tryp_SPc 176..402 CDD:238113 73/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24258
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.