DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11668 and teq

Sequence 1:NP_650254.1 Gene:CG11668 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_648288.2 Gene:teq FlyBaseID:FBgn0023479 Length:2792 Species:Drosophila melanogaster

Alignment Length:382 Identity:92/383 (24%)
Similarity:140/383 (37%) Gaps:104/383 (27%)


  Fly    80 WPNQLVC---------CPHGGY----------------LLPPPSISKSEQACANAYPRAHHKRRR 119
            |.:|::|         |.|..:                ..|||...:..|.....       .|.
  Fly  2443 WLDQVMCFGNETSIDQCNHWNWGEHNCNHTEDVALHCSAGPPPRSQRYSQTQIKG-------GRS 2500

  Fly   120 RRRNTNPK-LDQVELVE-----------------PIIQKHNQSQNLLVGGRLTQENEHPYMCALG 166
            ..|.|.|| ..|:.|.|                 .:..::...:..:|.|.:.|...||:...:.
  Fly  2501 LGRETTPKTYSQIGLWERSSKAVHTPRRCGIFKDDLTDEYAHREERVVRGNVAQRGRHPWQATIR 2565

  Fly   167 WPSR---TNRWIHEHGSSKRRYTFNCGCAMIAPRFAITAAHCASVGGESPSVALIGGVELNSGRG 228
            ...|   ::.|              ||..:|:.|..:|||||.....:......:|....|....
  Fly  2566 TRGRGGISSHW--------------CGAVVISKRHLLTAAHCLYGSPKGAYFVRVGDHYANIAES 2616

  Fly   229 QLIE--IKRISQHPHFDAET-LTNDLAVVKLAR----RSHMPVACL--WNQESLPERPLTALGYG 284
            ..::  |:....|.:|...| :.||:|:|.|..    ..::...||  .|.|.:.:|..|..|:|
  Fly  2617 SEVDSFIENWYLHENFRKGTHMNNDIALVVLKTPLKFSDYVQPICLPDKNAELVEDRKCTISGWG 2681

  Fly   285 QTKF-----AGPHSSNLLQIMLYHLNFQQCQRYLHNYDKLANGLGS----GQMCAGDYSGNMDTC 340
            ..|.     |....|..|.|:..|:    |        |.:|..||    |..|||....::|.|
  Fly  2682 SIKSGVSTPAQVLGSAELPILADHV----C--------KQSNVYGSAMSEGMFCAGSMDESVDAC 2734

  Fly   341 QGDSGGPLLLHQHMRHHRHTIPYVVGITSFGGACA-SGQPGVYVRIAHYIQWIEQQV 396
            :|||||||:...   ....|:   .|:.|:|..|. ..:||||||:.|||.||.:::
  Fly  2735 EGDSGGPLVCSD---DDGETL---YGLISWGQHCGFKNRPGVYVRVNHYIDWIYEKI 2785

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 75/268 (28%)
Tryp_SPc 149..392 CDD:214473 74/265 (28%)
teqNP_648288.2 CBM_14 65..115 CDD:279884
ChtBD2 136..184 CDD:214696
ChtBD2 215..261 CDD:214696
ChtBD2 284..327 CDD:214696
CBM_14 521..569 CDD:279884
ChtBD2 608..654 CDD:214696
ChtBD2 709..752 CDD:214696
CBM_14 782..830 CDD:279884
ChtBD2 864..909 CDD:214696
CBM_14 942..993 CDD:279884
RCR <1051..1126 CDD:304939
RCR <1116..1210 CDD:304939
ChtBD2 1324..1369 CDD:214696
ChtBD2 1474..1518 CDD:214696
LDLa 2193..2222 CDD:238060
SR 2229..2331 CDD:214555
SRCR 2234..2332 CDD:278931
LDLa 2337..2370 CDD:197566
SR 2382..2480 CDD:214555 5/37 (14%)
SRCR 2386..2480 CDD:278931 5/37 (14%)
Tryp_SPc 2546..2781 CDD:214473 74/267 (28%)
Tryp_SPc 2547..2784 CDD:238113 75/269 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24258
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.