DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11668 and ndl

Sequence 1:NP_650254.1 Gene:CG11668 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_523947.2 Gene:ndl FlyBaseID:FBgn0002926 Length:2616 Species:Drosophila melanogaster

Alignment Length:346 Identity:85/347 (24%)
Similarity:131/347 (38%) Gaps:100/347 (29%)


  Fly    89 HGGYLLPPPS----ISKSEQACANAYPRAHHKRRRRRRNTNPKLDQVELVEPIIQKHNQSQNLLV 149
            |..|:..||.    .|||...       .|.||.||..:     |..|:|         ....:|
  Fly  1103 HVAYVKCPPMQCGLPSKSSML-------EHSKRVRRAVS-----DSKEIV---------GDGRIV 1146

  Fly   150 GGRLTQENEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFAITAAHCASVGGE--- 211
            ||..|...:.|::.|          |:.:|.      |:||..:.:.|:.|:||||....|:   
  Fly  1147 GGSYTSALQWPFVVA----------IYRNGK------FHCGGTIYSDRWIISAAHCVINYGKYFY 1195

  Fly   212 ------------SPSVALIGGVELNSGRGQLIEIKRISQHPHFDAETLTNDLAVVKLA-----RR 259
                        ||:.             |:..:..:..|..::..::.|||::::|.     .|
  Fly  1196 EVRAGLLRRSSYSPAT-------------QIQPVSHVVVHQAYERRSMRNDLSLLRLLNPLQFNR 1247

  Fly   260 SHMPVACL-----------WNQESLPERPLTALGYGQTKFAGPHSSNLLQIMLYHLNFQQCQRYL 313
            ...|: ||           |....:.....|.:|:|..:..||.|..:.|:::      ..::..
  Fly  1248 WVKPI-CLPDKGRTTVGDDWIWGPVEHTLCTVVGWGAIREKGPSSDPMRQVIV------PIRKKC 1305

  Fly   314 HNYDKLANGLGSGQMCAGDYSGNMDTCQGDSGGPLLLHQHMRHHRHTIPYVVGITSFGGACASGQ 378
            .:.:..|    |..:||||..|..|.|||||||||...........   |:.|:.|.|..||..|
  Fly  1306 TDPEDQA----SEDICAGDPDGGRDACQGDSGGPLFCRSVSNPDEF---YLAGVVSHGNGCARPQ 1363

  Fly   379 P-GVYVRIAHYIQWIEQQVWP 398
            . |||.|:..|:.|:|....|
  Fly  1364 EFGVYTRVTLYLDWLEMATTP 1384

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 69/278 (25%)
Tryp_SPc 149..392 CDD:214473 68/275 (25%)
ndlNP_523947.2 LDLa 891..927 CDD:238060
Tryp_SPc 1144..1377 CDD:214473 67/276 (24%)
Tryp_SPc 1145..1379 CDD:238113 68/277 (25%)
LDLa 1399..1430 CDD:238060
Metaviral_G 1448..1600 CDD:118131
LDLa 1710..1743 CDD:238060
LDLa 1776..1811 CDD:238060
DUF1986 2041..2158 CDD:286432
LDLa 2309..2339 CDD:197566
LDLa 2350..2383 CDD:197566
LDLa 2421..2457 CDD:238060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24258
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.