DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11668 and CG30371

DIOPT Version :9

Sequence 1:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster


Alignment Length:271 Identity:87/271 - (32%)
Similarity:131/271 - (48%) Gaps:52/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 LVGGRLTQENEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFAITAAHCA-SVGGE 211
            :..|:....||.|.|.||            ...:|.:.:| ||..::|.|:.:|||||. .|...
  Fly   150 IANGQQAAANEFPSMAAL------------KDVTKNQASF-CGGTIVAHRYILTAAHCIYQVSRA 201

  Fly   212 SPSVALIGGVEL----NSGRGQLIEIKRISQHPHFDAE-TLTNDLAVVKLARRSHMPVACLWNQE 271
            :..||::|..:|    :|...|...|:::..|..:.:: .:.||:||:..|....      |::.
  Fly   202 TNIVAIVGTNDLGNPSSSRYYQQYNIQQMIPHEQYVSDPDVNNDIAVLITASNIQ------WSRG 260

  Fly   272 SLP--------ERPLT-----ALGYGQTKFAGPHSSNLLQIMLYHLNFQQCQRYLHNYDKLANGL 323
            ..|        ..|.|     .:|||...||||.|::|.:|.|..:..|.||.   .|:.:|. :
  Fly   261 VGPICLPPVGTSTPFTYDLVDVIGYGTVFFAGPTSTSLQKINLNVVTNQDCQT---EYNNVAT-I 321

  Fly   324 GSGQMCAGDYSG-NMDTCQGDSGGPLLLHQHMRHHRHTIPYVVGITSFGGACASGQ--PGVYVRI 385
            .:||||..|||| ..|:||.|||||::|       |.:..::|||.|:|.:||..|  .||..||
  Fly   322 YTGQMCTYDYSGTGRDSCQFDSGGPVIL-------RKSRQFLVGIISYGKSCAESQYPMGVNTRI 379

  Fly   386 AHYIQWIEQQV 396
            ..||.||.|::
  Fly   380 TSYISWIRQKI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 86/267 (32%)
Tryp_SPc 149..392 CDD:214473 84/264 (32%)
CG30371NP_610370.1 CUB 24..>67 CDD:294042
Tryp_SPc 149..386 CDD:214473 84/265 (32%)
Tryp_SPc 150..389 CDD:238113 86/268 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455973
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.