DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11668 and CG18477

Sequence 1:NP_650254.1 Gene:CG11668 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_609763.1 Gene:CG18477 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster

Alignment Length:421 Identity:101/422 (24%)
Similarity:156/422 (37%) Gaps:115/422 (27%)


  Fly     6 FGYRLILEFVLIS--TLAYAQNAPWN---------AVAPSYLSIDIYGNCQAHDRPLIGKCVRYV 59
            :|...|:..:|::  ..|..|||..|         ...|.::       |:......:....|.:
  Fly     5 YGIIAIVSLILVAGQVQAQGQNAELNQSCGASNEHQCVPRHM-------CKVKIEFRMAMTYRNL 62

  Fly    60 DCISAMQAVPRVTPLLCPSSWPNQLVCCPHGGYLLPPPSISKSEQACANAYPRAHHKRRRRRRNT 124
            .|:|.                   .:|||. ..::..|.:..:|..                  |
  Fly    63 GCVST-------------------AICCPK-NLIIKEPRLIINEPI------------------T 89

  Fly   125 NPKLDQVELVEPIIQKHNQSQNLLVGGR-----LTQENEHPYMCALGWPSRTNRWIHEHGSSKRR 184
            :|:...|           .|:.:....|     |.||.|.|:|.|| ..:||:.::         
  Fly    90 DPQCGFV-----------NSKGVTFSFREEDTGLAQEAEVPWMVAL-LDARTSSYV--------- 133

  Fly   185 YTFNCGCAMIAPRFAITAAHCASVGGESPSVALIGGVELNSGRGQL----IEIKRISQHPHFDAE 245
                .|.|:|||...|||.........|..|...|..:.::...||    :.|:.|.:||.|:.|
  Fly   134 ----AGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLE 194

  Fly   246 TLTNDLAVVKLARRS-----HMPVACLWNQESLPERP-------LTALGYGQTKFAGPHSSNLL- 297
            ...|::|:|.| |||     |:...|      :|..|       ....|:|:..|..|...|:| 
  Fly   195 NGANNVALVFL-RRSLTSSRHINPIC------MPSAPKNFDFSRCIFTGWGKNSFDDPSYMNVLK 252

  Fly   298 QIMLYHLNFQQCQRYLHNYDKLANGLGSGQMCAGDYSGNMDTCQGDSGGPLLLHQHMRHHRHTIP 362
            :|.|..:..:.|::.|..|......|.:..||||...|. |:|:||.|.||.........|:.: 
  Fly   253 KISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGK-DSCEGDGGSPLACAIKDNPQRYEL- 315

  Fly   363 YVVGITSFGGACA-SGQPGVYVRIAHYIQWI 392
              .||.:||..|. .|.|.||..:|:.|:||
  Fly   316 --AGIVNFGVDCGLPGVPAVYTNVANVIEWI 344

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 79/268 (29%)
Tryp_SPc 149..392 CDD:214473 78/266 (29%)
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 76/256 (30%)
Tryp_SPc 113..344 CDD:238113 76/256 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24258
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.