| Sequence 1: | NP_650254.1 | Gene: | CG11668 / 41606 | FlyBaseID: | FBgn0038113 | Length: | 398 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001259904.1 | Gene: | CG4259 / 33385 | FlyBaseID: | FBgn0031389 | Length: | 270 | Species: | Drosophila melanogaster | 
| Alignment Length: | 236 | Identity: | 48/236 - (20%) | 
|---|---|---|---|
| Similarity: | 82/236 - (34%) | Gaps: | 72/236 - (30%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly   192 AMIAPRFAITAAHCASVGGESPSVALIGGVELNSGRGQL---IEIKRISQHPHFDAETLTNDLAV 253 
  Fly   254 VKLARRSHMPV-----------------ACLWNQESLPERPLTALGYGQTKFAGPHSSNLLQIML 301 
  Fly   302 YHLNFQQCQRYLHNYDKLANGLGSG------QMCAGDYSGNMDTCQGDSGGPLLLHQHMRHHRHT 360 
  Fly   361 IPY---VVGITSFGGACASGQPG-----VYVRIAHYIQWIE 393 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG11668 | NP_650254.1 | Tryp_SPc | 149..395 | CDD:238113 | 48/236 (20%) | 
| Tryp_SPc | 149..392 | CDD:214473 | 46/233 (20%) | ||
| CG4259 | NP_001259904.1 | Tryp_SPc | 39..259 | CDD:238113 | 48/236 (20%) | 
| Tryp_SPc | 39..256 | CDD:214473 | 46/233 (20%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR24258 | 
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||