DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11668 and psh

Sequence 1:NP_650254.1 Gene:CG11668 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster

Alignment Length:440 Identity:100/441 (23%)
Similarity:172/441 (39%) Gaps:123/441 (28%)


  Fly    28 WNAVAPSYLSIDIYGNCQAHDRPL-IGKCVRYVD-----CISAMQAVPRVTPLL---------CP 77
            |:.:..:::.|    :|.:.:..: :|:..:..|     |.::....|.:...:         .|
  Fly     5 WSLLLGTFVLI----SCSSVEAAVTVGRACKVTDTMPGICRTSSDCEPLIDGYIKSGVLTLNDVP 65

  Fly    78 S----SWPNQLVCCPHGGYLLPP-----------------------------PSISKSEQACANA 109
            |    :| .::.|||     ..|                             |:....::....|
  Fly    66 SCGLGAW-GEIFCCP-----TKPCCDNSTITSVSTSSTTSTKAPMTSGRVDVPTFGSGDRPAVAA 124

  Fly   110 YPRAHHKRRRRRRNTNPKLDQVELVEPIIQKHNQSQNLLVGGRLTQENEHPYMCALGWPSRTNRW 174
            ..:...::::|..|        :||..|           |||.......:|:|.|:|:.:     
  Fly   125 CKKIRERKQQRSGN--------QLVIHI-----------VGGYPVDPGVYPHMAAIGYIT----- 165

  Fly   175 IHEHGSSKRRYTFNCGCAMIAPRFAITAAHCASVGGESPSVALIGGVELNS--GRGQLIEIKRIS 237
               .|:.     |.||.::||.||.:|||||.:....:|:...:|.|.:.:  ...|.|.|:.:.
  Fly   166 ---FGTD-----FRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNIENPDHSYQDIVIRSVK 222

  Fly   238 QHPHFDAETLTNDLAVVKLAR----RSHMPVACLWNQESLPERPLTALGYGQTKF--AG------ 290
            .||.:..... ||:|:::|.|    ..::..|||....:.|.        ..:||  ||      
  Fly   223 IHPQYVGNKY-NDIAILELERDVVETDNIRPACLHTDATDPP--------SNSKFFVAGWGVLNV 278

  Fly   291 ---PHSSNLLQIMLYHLNFQQCQ-RYLH---NYDKLANGLGSGQMCAGDYSGNMDTCQGDSGGPL 348
               ..|..||:..|..:...||. .|..   :...|..|:....:||.|.....|.|:|||||||
  Fly   279 TTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCAIDQKLIADACKGDSGGPL 343

  Fly   349 LLHQHMRHHRHTIPYVVGITSFGGACASGQPGVYVRIAHYIQWIEQQVWP 398
            :...::....:||   :|:.|.|..||:..||:|.|::.|:.:||..|||
  Fly   344 IHELNVEDGMYTI---MGVISSGFGCATVTPGLYTRVSSYLDFIEGIVWP 390

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 76/267 (28%)
Tryp_SPc 149..392 CDD:214473 74/264 (28%)
pshNP_573297.1 CLIP 30..79 CDD:197829 8/50 (16%)
Tryp_SPc 143..384 CDD:214473 75/277 (27%)
Tryp_SPc 144..387 CDD:238113 77/279 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BRA1
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D476534at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.