DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11668 and gd

DIOPT Version :9

Sequence 1:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001259479.1 Gene:gd / 32159 FlyBaseID:FBgn0000808 Length:531 Species:Drosophila melanogaster


Alignment Length:274 Identity:55/274 - (20%)
Similarity:109/274 - (39%) Gaps:57/274 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 WPSRTNRWIHE-HGSSKRRYTFNCGCAMIAPRFAITAAHCASVGGE----SPSVALIGGVELN-- 224
            ||     |:.. :.::.....|.||.::::.|..|::|||..:..:    :..:..:|...|.  
  Fly   262 WP-----WLAAIYVNNLTSLDFQCGGSLVSARVVISSAHCFKLFNKRYTSNEVLVFLGRHNLKNW 321

  Fly   225 SGRGQL-IEIKRISQHPHFDAE--TLTNDLAVV----KLARRSHMPVACLWNQES-----LPERP 277
            :..|.| ..:..|..||.|:::  :...|:||:    ::...:.:..||||:..|     :.||.
  Fly   322 NEEGSLAAPVDGIYIHPDFNSQLSSYDADIAVIILKDEVRFNTFIRPACLWSGSSKTEYIVGERG 386

  Fly   278 LTALGYG------------QTKFAGPHSSNLLQ---IMLYHLNFQQCQRYLHNYDKLANGLGSGQ 327
            : .:|:.            .::..|..|::...   :....:...:|.|...::..|::   :..
  Fly   387 I-VIGWSFDRTNRTRDQKLSSELPGKKSTDASAPKVVKAPIVGNAECFRANAHFRSLSS---NRT 447

  Fly   328 MCAGDYSGNMDTCQ-------GDSGGPLLLHQHMRHH-RHTIPYVVGITSFGGA------CASGQ 378
            .|||..:...||.|       |.||..|.:.::.|.. |.|:...:.......|      |...|
  Fly   448 FCAGIQAEERDTHQSGASIYTGISGAGLFIRRNNRWMLRGTVSAALPAVETPDAESSHKLCCKNQ 512

  Fly   379 PGVYVRIAHYIQWI 392
            ..:|..:|.::.||
  Fly   513 YIIYADVAKFLDWI 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 55/274 (20%)
Tryp_SPc 149..392 CDD:214473 53/272 (19%)
gdNP_001259479.1 GD_N 27..124 CDD:292649
Tryp_SPc 257..526 CDD:238113 53/272 (19%)
Tryp_SPc 258..526 CDD:214473 53/272 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456102
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.