DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11668 and Ser7

Sequence 1:NP_650254.1 Gene:CG11668 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_572582.1 Gene:Ser7 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster

Alignment Length:407 Identity:111/408 (27%)
Similarity:166/408 (41%) Gaps:91/408 (22%)


  Fly    41 YGNCQAHD--RPLIGKCVRYVDCISAMQAVPRVTPLL----CPSSWPNQLVCCPHGGYLLPP--P 97
            :|||.:.:  |   |.|:...||  ...||.::..|.    |.|.....|||||....::||  |
  Fly    26 FGNCNSVEFGR---GTCIEKKDC--DFYAVDKLMELASKQQCFSRQRPDLVCCPRETNIIPPLAP 85

  Fly    98 SISK------SEQACANAYPRAHHKRRRRRRNTNPK----LDQVELVEPIIQKHNQSQNL----L 148
            .||.      |........||           |.|:    :||       :.:|....:.    |
  Fly    86 RISNGTTNATSSTTTLKLLPR-----------TTPRPPSGIDQ-------LPEHPYCGSAFSFRL 132

  Fly   149 VGGRLTQENEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFAITAAHCASVGGESP 213
            |||..|...|.|:...|.         :|..|..:.|.  ||.:.||.|:.:|||||....|.:.
  Fly   133 VGGHNTGLFEFPWTTLLE---------YETVSGGKDYA--CGASFIAQRWLLTAAHCIHTMGRNL 186

  Fly   214 SVALIG---------------GVELNSGRGQLIEIKRISQHPHFDAETLTNDLAVVKLAR----- 258
            :.|::|               ||...:.....:.|.||..|..:......||:|:::|:|     
  Fly   187 TAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWL 251

  Fly   259 -RSHMPVACLWNQ-----ESLPERPLTALGYGQTKFAGPHSSNLLQIMLYHLNFQ-QCQRYLHNY 316
             ..::...||..|     ..|........|:|:|:.:|  ||.:.|..:.|:..| |||...:..
  Fly   252 QMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSG--SSKIKQKAMLHIQPQDQCQEAFYKD 314

  Fly   317 DKLANGLGSGQMCAGDYSGNMDTCQGDSGGPLLLHQHMRHHRHTIPYVVGITSFGGA-CASGQ-P 379
            .|:.  |...|||||...| :|:|.|||||||.:..:.......: |:.|:.|.|.. |.:.. .
  Fly   315 TKIT--LADSQMCAGGEIG-VDSCSGDSGGPLTVEANTASGNRYV-YLAGVVSIGRKHCGTALFS 375

  Fly   380 GVYVRIAHYIQWIEQQV 396
            |:|.|::.|:.|||..:
  Fly   376 GIYTRVSSYMDWIESTI 392

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 79/275 (29%)
Tryp_SPc 149..392 CDD:214473 77/272 (28%)
Ser7NP_572582.1 CLIP 29..74 CDD:197829 15/50 (30%)
Tryp_SPc 131..388 CDD:214473 78/274 (28%)
Tryp_SPc 133..391 CDD:238113 79/275 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C47700
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24258
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.