DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11668 and CG32260

Sequence 1:NP_650254.1 Gene:CG11668 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_728942.1 Gene:CG32260 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster

Alignment Length:426 Identity:109/427 (26%)
Similarity:170/427 (40%) Gaps:118/427 (28%)


  Fly    43 NCQ-AHDRPLIGKCVRYVDCISAMQAVPR--------VTPLLCPSSWPNQLVCC----------- 87
            :|| |..||  |.|:....|...||....        :...:|.......:|||           
  Fly   193 SCQDARSRP--GSCLPLTSCPQLMQEYQGQANEFHTFLGQSICGFDGSTFMVCCATDRSGNARSR 255

  Fly    88 ---------PHGGYLLPPPSISKSEQACANAYPRAHHKRRRRRRNTNPKLDQVELVEPIIQK--- 140
                     |.|.:...|.|      ..:.|.|...        ...|.|.||  |.|....   
  Fly   256 KDVFVTTAAPFGFFHFSPLS------GGSTATPMVF--------QPTPPLSQV--VSPSFYPPPP 304

  Fly   141 ----------------HNQSQNLLVGGRLTQENEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNC 189
                            ...:.|.:|||...::..:|::.|||:....||         ....|.|
  Fly   305 PPPPNNAPRESATCGISGATSNRVVGGMEARKGAYPWIAALGYFEENNR---------NALKFLC 360

  Fly   190 GCAMIAPRFAITAAHCASVGGESPSVALI--GGVELN----SGRGQLIEIKRISQHPHFDAETLT 248
            |.::|..|:.||:|||.     :|.:.|:  |..:|:    ||...| .|:|...|.|||..:::
  Fly   361 GGSLIHSRYVITSAHCI-----NPMLTLVRLGAHDLSQPAESGAMDL-RIRRTVVHEHFDLNSIS 419

  Fly   249 NDLAVVKL----ARRSHMPVACL------WNQESLPERPLTALGYGQTKFAGPHSSNLLQIMLYH 303
            ||:|:::|    |...::...||      ..|:.:...|..| |:|..|..|..|..|....:..
  Fly   420 NDIALIELNVVGALPGNISPICLPEAAKFMQQDFVGMNPFVA-GWGAVKHQGVTSQVLRDAQVPI 483

  Fly   304 LNFQQCQ-------RYLHNYDKLANGLGSGQMCAGDYSGNMDTCQGDSGGPLLLHQHMRHHRHTI 361
            ::...|:       :::...||:        :|||  |.::|.|||||||||::.| :..:.:..
  Fly   484 VSRHSCEQSYKSIFQFVQFSDKV--------LCAG--SSSVDACQGDSGGPLMMPQ-LEGNVYRF 537

  Fly   362 PYVVGITSFGGACASGQ-PGVYVRIAHYIQWIEQQV 396
             |::|:.|||..||... ||||.|:|.|:.||::.:
  Fly   538 -YLLGLVSFGYECARPNFPGVYTRVASYVPWIKKHI 572

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 82/270 (30%)
Tryp_SPc 149..392 CDD:214473 81/267 (30%)
CG32260NP_728942.1 CLIP 194..244 CDD:288855 13/52 (25%)
Tryp_SPc 327..568 CDD:214473 81/269 (30%)
Tryp_SPc 328..571 CDD:238113 82/271 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48160
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24258
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.