DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11668 and CG1632

Sequence 1:NP_650254.1 Gene:CG11668 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001245577.1 Gene:CG1632 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster

Alignment Length:365 Identity:74/366 (20%)
Similarity:102/366 (28%) Gaps:170/366 (46%)


  Fly    42 GNCQAHDRPLIGKCVRYVDCISAMQA---VPRV------TPLL-----CPSSWPNQLVC------ 86
            |....|.:|         .|:|.||:   .||:      .|.|     |....||.|.|      
  Fly   494 GTQSCHQKP---------HCVSDMQSNVQSPRLCDGYADCPDLSDERSCAFCSPNALYCGRGRAC 549

  Fly    87 ------------CPHG-------------GYLLPP----PSISKSEQA--------------CAN 108
                        ||.|             ..||.|    |.:|:...|              ||.
  Fly   550 VPRKARCDGKADCPDGADEKDCLSIAPLAADLLQPEPLVPYLSRFHSAGYAVFSEKGVVGKLCAE 614

  Fly   109 AYPRAHHKRRRRR--------------------RNTNPKL-DQVELVEP------IIQKH-NQSQ 145
            .. ....|...|:                    :|...:| |.|.:::|      .|:.| .:.|
  Fly   615 GL-EGDAKLVVRQTVSESLCKSLGYESVEIFDVQNDTERLNDYVRVLDPHAPEISFIRTHCPRRQ 678

  Fly   146 NLLVG---------GRLTQENEH---PYMCALG-WPSRTNRW--------IHEHGSSKRRYTFNC 189
            .|.||         ..|....:|   |.|.|.| ||     |        ||.           |
  Fly   679 VLYVGCGELRCGVQSALFNAKQHLSLPKMSAPGDWP-----WLVALFREDIHV-----------C 727

  Fly   190 GCAMIAPRFAITAAHCASVGGESPSVALIGGVELNSGRGQLIEIKRISQHPHFDAETLTNDLAVV 254
            ...:|...:.:|...|......:..:|::|.|.| |.:....:.:||........|..|  .|:|
  Fly   728 DGTLITQDWVLTTEGCFQGQPRATWMAIVGAVRL-SAKAPWTQRRRIIGMIKSPVEGST--AALV 789

  Fly   255 KL-----------------------------ARRSHMPVA 265
            :|                             .||||:|||
  Fly   790 RLETPVSYSDHVRPICLPDALQRRLLQQPPAQRRSHVPVA 829

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 36/168 (21%)
Tryp_SPc 149..392 CDD:214473 36/168 (21%)
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549 2/8 (25%)
PRKCSH-like <503..>582 CDD:193472 17/79 (22%)
LDLa 536..571 CDD:238060 7/35 (20%)
Tryp_SPc 708..>809 CDD:304450 23/120 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24258
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.