DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11668 and Gzmk

Sequence 1:NP_650254.1 Gene:CG11668 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_058815.1 Gene:Gzmk RGDID:68401 Length:258 Species:Rattus norvegicus

Alignment Length:283 Identity:78/284 (27%)
Similarity:125/284 (44%) Gaps:52/284 (18%)


  Fly   131 VELVEPIIQKHNQSQNLLVGGRLTQENEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIA 195
            |.||..|..........::|||..|.:..|:|.::.:                |....||..:|.
  Rat     9 VFLVAGIYMSSESFHTEIIGGREVQPHSRPFMASIQY----------------RGKHICGGVLIH 57

  Fly   196 PRFAITAAHCASVGGESPSVALIGGVEL--NSGRGQLIEIKRISQHPHFDAETLTNDLAVVKLAR 258
            |::.:|||||.| .|.||:|.| |...|  |....|..|||...  |....::.|||:.::||..
  Rat    58 PQWVLTAAHCYS-RGHSPTVVL-GAHSLSKNEPMKQTFEIKEFI--PFSGFKSGTNDIMLIKLRT 118

  Fly   259 ----RSHMPVACLWNQESLPE-RPLTALGYGQTKFAGPH----SSNLLQIMLYHLNFQQC--QRY 312
                ..|:.:..|.::..:.: ......|:|.||   |.    |..|.::.:..::.::|  |.|
  Rat   119 AAELNKHVQLLHLRSKNYIRDGTKCQVTGWGSTK---PDVLTTSDTLQEVTVTIISRKRCNSQSY 180

  Fly   313 LHNYDKLANGLGSGQMCAGDYSGNMDTCQGDSGGPLLLHQHMRHHRHTIPYVVGITSFGGACA-S 376
            .::...:...:    :||||..|..|:|:|||||||:. :.:.|         .:.|.|..|. |
  Rat   181 YNHKPVITKDM----ICAGDRRGEKDSCKGDSGGPLIC-KGVFH---------ALVSGGYKCGIS 231

  Fly   377 GQPGVYVRIA-HYIQWIEQQVWP 398
            .:||||..:. .|..||:.::.|
  Rat   232 NKPGVYTLLTKKYQTWIKSKLAP 254

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 73/261 (28%)
Tryp_SPc 149..392 CDD:214473 72/258 (28%)
GzmkNP_058815.1 Tryp_SPc 25..248 CDD:214473 72/260 (28%)
Tryp_SPc 26..251 CDD:238113 73/262 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.