DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11668 and svh-1

Sequence 1:NP_650254.1 Gene:CG11668 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_501379.2 Gene:svh-1 WormBaseID:WBGene00006620 Length:951 Species:Caenorhabditis elegans

Alignment Length:260 Identity:67/261 (26%)
Similarity:114/261 (44%) Gaps:45/261 (17%)


  Fly   148 LVGGRLTQENEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFAITAAHCASVGGES 212
            :|||..|.....|:..||              .:|.....:||.:::.....||||||.......
 Worm   713 VVGGFETVPGAFPWTAAL--------------RNKATKAHHCGASILDKTHLITAAHCFEEDERV 763

  Fly   213 PSVALIGGVELNS---GRGQLIEIKRISQHPHFDAETLTNDLAVVKLA------RRSHMPVACLW 268
            .|..::.|...|:   |..|:..::||..:|.: .:..::|:|::::.      .....|: ||.
 Worm   764 SSYEVVVGDWDNNQTDGNEQIFYLQRIHFYPLY-KDIFSHDIAILEIPYPGIEFNEYAQPI-CLP 826

  Fly   269 NQESL--PERPLTALGYGQ--TKFAGPHSSNLLQIMLYHLNFQQCQRYLHNYDKLANGLGSGQMC 329
            :::.:  |.|.....|:|.  .::|....:.|:.|    :|...|.    |..::.:.:.....|
 Worm   827 SKDFVYTPGRQCVVSGWGSMGLRYAERLQAALIPI----INRFDCV----NSSQIYSSMSRSAFC 883

  Fly   330 AGDYSGNMDTCQGDSGGPLLLHQHMRHHRHTIPYVV-GITSFGGACA-SGQPGVYVRIAHYIQWI 392
            ||...|.:|:||||||||...      .|....:|: |:.|:|..|| ..|||:|..:|.|:.||
 Worm   884 AGYLEGGIDSCQGDSGGPFAC------RREDGAFVLAGVISWGDGCAQKKQPGIYTMVAPYLSWI 942

  Fly   393  392
             Worm   943  942

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 67/260 (26%)
Tryp_SPc 149..392 CDD:214473 66/258 (26%)
svh-1NP_501379.2 KR 227..306 CDD:214527
LDLa 320..355 CDD:238060
PAN_AP_HGF 373..434 CDD:238532
LDLa 558..590 CDD:197566
SRCR_2 599..681 CDD:295335
Tryp_SPc 712..942 CDD:214473 66/259 (25%)
Tryp_SPc 713..945 CDD:238113 67/261 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.