DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11668 and try-1

Sequence 1:NP_650254.1 Gene:CG11668 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans

Alignment Length:299 Identity:80/300 (27%)
Similarity:126/300 (42%) Gaps:69/300 (23%)


  Fly   123 NTNPKLDQV----ELVEPIIQKHNQSQNLLVGGRLTQENEHPYMCALGWPSRTNRWIHEHGSSKR 183
            :||.:|.|.    |..:.:...|.     |:||  ::.:.|      .||     |..:..|  |
 Worm    34 STNVELAQTRSAQEPADYVTLDHR-----LIGG--SESSPH------SWP-----WTVQLLS--R 78

  Fly   184 RYTFNCGCAMIAPRFAITAAHCASVGGESPSVAL-IGGVELNSGRGQLIEIKRISQHPHFDAETL 247
            .....||.::|.|.|.:|||||.:......|.:: :||  ..||.|....:..:|.||.::....
 Worm    79 LGHHRCGGSLIDPNFVLTAAHCFAKDRRPTSYSVRVGG--HRSGSGSPHRVTAVSIHPWYNIGFP 141

  Fly   248 TN-DLAVVKLARRSHMPV--------ACLWNQESLPERPLTALGYGQT----KFAGPHSSNLLQI 299
            :: |.|::::    |.||        .||.:..::..|.....|:|.|    ..:.|   .|.:|
 Worm   142 SSYDFAIMRI----HPPVNTSTTARPICLPSLPAVENRLCVVTGWGSTIEGSSLSAP---TLREI 199

  Fly   300 MLYHLNFQQCQRYLHNYDKLANGLG----SGQMCAGDYSGNMDTCQGDSGGPLLLHQ--HMRHHR 358
            .:..|:...|       ..|.|.:|    ...:|||...|.:|:|||||||||:..:  |..   
 Worm   200 HVPLLSTLFC-------SSLPNYIGRIHLPSMLCAGYSYGKIDSCQGDSGGPLMCARDGHWE--- 254

  Fly   359 HTIPYVVGITSFGGACA-SGQPGVYVRIAHYIQWIEQQV 396
                 :.|:.|:|..|| .|.||||..:.....||..::
 Worm   255 -----LTGVVSWGIGCARPGMPGVYGNVHSASTWINLEM 288

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 73/267 (27%)
Tryp_SPc 149..392 CDD:214473 72/264 (27%)
try-1NP_494910.2 Tryp_SPc 57..284 CDD:214473 73/271 (27%)
Tryp_SPc 59..285 CDD:238113 73/265 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.