DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11668 and si:dkey-78l4.13

Sequence 1:NP_650254.1 Gene:CG11668 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_003201101.3 Gene:si:dkey-78l4.13 ZFINID:ZDB-GENE-060503-459 Length:253 Species:Danio rerio

Alignment Length:258 Identity:67/259 (26%)
Similarity:123/259 (47%) Gaps:52/259 (20%)


  Fly   148 LVGGRLTQENEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFAITAAHCASVGGES 212
            :|.|...:.:..|||.::    :.||   :|         .||..:::.:|.:||||| .|.|:.
Zfish    25 IVNGNEARPHSRPYMVSV----QCNR---KH---------ICGGFLVSEQFVMTAAHC-FVNGKE 72

  Fly   213 PSVALIGGVELNSGRGQLIEIKRISQHPHFDAETLTNDLAVVKLARRSHMPVACLW------NQE 271
            .:| ::|..|...|..:: ::|....||.|:::||.||:.:::|.::........|      :::
Zfish    73 LTV-VVGAHEYTDGASRM-DVKFYHIHPGFESKTLLNDIMLLQLHKKVKKSNKVNWIPIPNADKD 135

  Fly   272 SLPERPLTALGYGQTKFAGPHSSNLLQIMLYHLNFQQCQRY---LHNYDKLANGLGSGQMCAGDY 333
            ...:...:..|:|:....|..|:.|:::.:...:.:.||:|   .::..|:        ||.|.:
Zfish   136 IKAKTKCSVAGWGKNTTHGEVSAKLMEVNVTLFDKKACQKYWGPTYSTSKM--------MCTGGH 192

  Fly   334 SGNMDTCQGDSGGPLLLHQHMRHHRHTIPYVVGITSFG--GACAS-GQPGVYVRIAHYIQWIE 393
            .|   .|||||||||:..:          ..|||.||.  ..|.| .:|.||.:|:.::.||:
Zfish   193 GG---FCQGDSGGPLVCDK----------VAVGIVSFNEKNNCDSPTKPNVYTQISKFLSWIK 242

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 67/258 (26%)
Tryp_SPc 149..392 CDD:214473 66/255 (26%)
si:dkey-78l4.13XP_003201101.3 Tryp_SPc 25..242 CDD:238113 67/257 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.