DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ARSF and CG7402

Sequence 1:XP_011543824.1 Gene:ARSF HGNCID:721 Length:607 Species:Homo sapiens
Sequence 2:NP_649023.1 Gene:CG7402 FlyBaseID:FBgn0036768 Length:579 Species:Drosophila melanogaster

Alignment Length:593 Identity:148/594 (25%)
Similarity:230/594 (39%) Gaps:163/594 (27%)


Human    43 HDDKPNIVLIMVDDLGIGDLGCYGNDTMRTPHIDRLAREGVRLTQHISAASLCSPSRSAFLTGRY 107
            :..|||||:|::||:|:.|:..:|::.:.||:||.||..|:.|.:|. ..:||:|||:..|||:|
  Fly    24 YSTKPNIVIILIDDMGMNDVSFHGSNQILTPNIDALAYNGILLNKHY-VPNLCTPSRATLLTGKY 87

Human   108 PIRSGMVSSGNRRVIQNLAV----PAGLPLNETTLAALLKKQGYSTGLIGKWHQG-----LNCDS 163
            ||.:||         |:..:    |.|||..|..:..:.:..||||.|:||||.|     |....
  Fly    88 PIHTGM---------QHFVIITDEPWGLPQRERLMPEIFRDAGYSTHLVGKWHLGFWRKDLTPTM 143

Human   164 RSDQCHHPYNYGFDYYYGMPFTLVDSCWPDPSRNTELAFESQLWLCVQLVAIAILTLTFGKLSGW 228
            |....|..|..|:..||.....::|       ||.....:                         
  Fly   144 RGFDHHFGYYNGYIDYYDHQVRMLD-------RNYSAGLD------------------------- 176

Human   229 VSVPWLLIFSMILFIFLLGYAWFSSHTSPLYWDCLLMRGHEITEQPMKAERAGSIMVKEAISFLE 293
                                  |.....|    |....|...||          ....||...:|
  Fly   177 ----------------------FRRDLEP----CPEANGTYATE----------AFTSEAKRIIE 205

Human   294 RHSK-ETFLLFFSFLHVHT-----PLPTTDDFTGTSKH------GLYGDNVEEMDSMVGKILDAI 346
            :|.| :...:..|.|.|||     |:...::......|      ..|...:..:|..|.:.:.|:
  Fly   206 QHDKSKPLFMVLSHLAVHTGNEDSPMQAPEEEVAKFPHIRDPKRRTYAGMISSLDKSVAQTIGAL 270

Human   347 DDFGLRNNTLVYFTSDHGGHLEARRGHAQLGGWNGIYKGGKGMGGWEGGIRVPGIVRWPGKVPAG 411
            .|.|:.||:::...||:|........:|   |.|..|:|.| ...||||||..|.:..|.....|
  Fly   271 KDNGMLNNSIILLYSDNGAPTIGIHSNA---GSNYPYRGQK-ESPWEGGIRSAGALWSPLLKERG 331

Human   412 RLIKEPTSLMDILPTVASVSGGSLPQDRVIDGRDLMPLLQGNVRHSEHEFL------FHYCGSYL 470
            .:..:....:|.|||:|..:|.|||||..:||.:|.|:|.||........:      |.| .||:
  Fly   332 YVSNQAIHAVDWLPTLAGAAGVSLPQDLPLDGINLWPMLSGNEEPKPRTMIHVLDEVFGY-SSYM 395

Human   471 HAV--------------RWIPK------DDSGSVWKAHYVTPVFQ-------------------- 495
            ...              :|:.:      |..|..::.|.:....|                    
  Fly   396 RDTLKYVNGSSFKGRYDQWLGELETNEDDPLGESYEQHVLASDVQSLLGNRGLTKDRIRQMRSEA 460

Human   496 ----PPASGGCYVTSLCRCFGEQVTYHNPPLLFDLSRDPSESTPLTPATEPLHDFVIKKVANALK 556
                ||..|...:.|..:|  |.:   ..|..|||::||.|...|.    .::...::::|:.|:
  Fly   461 TETCPPIEGQNPLESHFKC--EPL---KAPCFFDLAKDPCERYNLA----QMYPLQLQQLADELE 516

Human   557 EHQETIVP 564
            :.::|.:|
  Fly   517 QIRKTAIP 524

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ARSFXP_011543824.1 AslA 44..560 CDD:225661 146/587 (25%)
ALP_like 46..570 CDD:304875 148/591 (25%)
CG7402NP_649023.1 PRK13759 25..459 CDD:237491 130/517 (25%)
4-S 28..436 CDD:293753 128/491 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87975634
eggNOG 1 0.900 E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.