DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Vb and zgc:172120

DIOPT Version :8

Sequence 1:NP_001262511.1 Gene:beat-Vb / 41583 FlyBaseID:FBgn0038092 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001121748.1 Gene:zgc:172120 / 799440 ZFINID:ZDB-GENE-080204-46 Length:273 Species:Danio rerio

Alignment Length:36 Identity:12/37 (32%)
Similarity:19/37 (51%) Gaps:3/37 (8%)


  Fly    32 PQI--VDFRDNVTLSCSYDISGHTLNSVKWYKNGKE 65
            |::  ||..|. ||||..::..||.:.:...|:..|
Zfish   158 PEVIWVDEHDQ-TLSCPLELLKHTEDGLYLIKSRYE 192

Known Domains:


GeneSequenceDomainRegion External IDIdentity
beat-VbNP_001262511.1 IG_like 39..121 CDD:214653 9/28 (32%)
Ig 41..130 CDD:143165 8/26 (31%)
zgc:172120NP_001121748.1 IG_like 23..127 CDD:214653
Ig 30..126 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I5406
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.