DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Vb and beat-Ia

DIOPT Version :8

Sequence 1:NP_001262511.1 Gene:beat-Vb / 41583 FlyBaseID:FBgn0038092 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001285975.1 Gene:beat-Ia / 34947 FlyBaseID:FBgn0013433 Length:437 Species:Drosophila melanogaster

Alignment Length:253 Identity:73/254 (29%)
Similarity:109/254 (43%) Gaps:49/254 (19%)


  Fly     7 LLQLGVHMLLVVRRIQCLRVTDINVPQIVDFRDNVTLSCSYDISGHTLNSVKWYKNGKEFFRYSP 71
            ||.|.:.|...:|.::      :.||..|...:...|.|.|||...:|.||||||..:||:||:|
  Fly    16 LLALTLEMTAALRDVR------VRVPHAVRRSEKAILKCFYDIEDDSLYSVKWYKGRREFYRYTP 74

  Fly    72 L-TPPTYIPFAVEGVQLIDDGNECNESSCRVELNLLGVKSSGVYRCEVSGDAPHFQLTARDANMT 135
            . |||..: |...||::    ...:.:..:|.|:.:.:.:||.|.||||.|||.|......|.:.
  Fly    75 KETPPMKV-FHFPGVKV----RRVSSNESQVVLDAVTMATSGKYSCEVSADAPSFHTLIAAAELE 134

  Fly   136 VEALPQNNPLISSFHSTYRFNDFVEVNCSTDFSSLFTRITWYVNGIKVS---------LVDLLPS 191
            |...|.|.|.|:.....||..|.:..||::..|.....:||.||..:|:         |.|....
  Fly   135 VIETPHNAPFITGIRPRYRVGDILRGNCTSRHSRPAANLTWTVNNEEVNPALVRHHKILRDARND 199

  Fly   192 FETTIVAHGYSMRRIVSQLNFYANEPRFHQLQLQKLIQQKRTISPARLGLELRCVAEI 249
            .||.:|.           ::|...:..|...:                 |:|||.|::
  Fly   200 METAVVG-----------IHFVVTDQHFDNGK-----------------LKLRCSAQL 229

Known Domains:


GeneSequenceDomainRegion External IDIdentity
beat-VbNP_001262511.1 IG_like 39..121 CDD:214653 32/83 (39%)
Ig 41..130 CDD:143165 36/90 (40%)
beat-IaNP_001285975.1 Ig 32..118 CDD:299845 34/91 (37%)
Ig 161..240 CDD:299845 20/98 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124149120
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001856
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21261
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.