DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Su(fu) and SUFU

Sequence 1:NP_536750.2 Gene:Su(fu) FlyBaseID:FBgn0005355 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_011538160.1 Gene:SUFU HGNCID:16466 Length:527 Species:Homo sapiens

Alignment Length:531 Identity:180/532 (34%)
Similarity:255/532 (48%) Gaps:128/532 (24%)


  Fly    15 PPGLKAIIDHLGQVYPNQPNPLQVTTLLKYWLGGQDPLDYISMYNYPGDVDRNVPPHWHYISFGL 79
            ||||.||.....::||:||||||||.::||||||.|||||:|||...|....|:|.|||||||||
Human    31 PPGLHAIYGECRRLYPDQPNPLQVTAIVKYWLGGPDPLDYVSMYRNVGSPSANIPEHWHYISFGL 95

  Fly    80 SDLHGDERVHLREEGVTRSGMGFELTFRLAKTEIELKQQIENPEKPQRPPTWPANLLQAIGRYCF 144
            |||:||.|||........||.||||||||.:...|           ..||||||.|:|.:.||.|
Human    96 SDLYGDNRVHEFTGTDGPSGFGFELTFRLKRETGE-----------SAPPTWPAELMQGLARYVF 149

  Fly   145 QTGNGLCFGDNIPWRKSLDGSTTSKLQNLLVAQDPQLGCIDTPTGTVDFCQIVGVFDDELEQASR 209
            |:.|..|.||::.|...||.| .|::|::|:.:|||:..:.||.|.|.|.|||||..:||..|.:
Human   150 QSENTFCSGDHVSWHSPLDNS-ESRIQHMLLTEDPQMQPVQTPFGVVTFLQIVGVCTEELHSAQQ 213

  Fly   210 WNGRGVLNFLRQDMQTGGDWLVTNMDRQMSVFELFPETLLNLQDD-----LEKQGSDLAGVNADF 269
            |||:|:|..||.....||.||:|:|.|..::||:.|    :||.:     :|..||:|:||:|..
Human   214 WNGQGILELLRTVPIAGGPWLITDMRRGETIFEIDP----HLQQERVDKGIETDGSNLSGVSAKC 274

  Fly   270 TFRELKPTKEVKEEVDFQALSEKCANDENNRQL-----------TDTQMKRE----------EPS 313
            .:.:|....|               :||::|.:           .||:..||          :|.
Human   275 AWDDLSRPPE---------------DDEDSRSICIGTQPRRLSGKDTEQIRETLRRGLEINSKPV 324

  Fly   314 FPQSMSMSSNSL-HKSCPL---DFQAQAPNCI---------SLDGIEITLAPGVAKYLLLAIKDR 365
            .|.......|.| |...|.   ..::.:...|         .|:.:.:.........:.|.::.|
Human   325 LPPINPQRQNGLAHDRAPSRKDSLESDSSTAIIPHELIRTRQLESVHLKFNQESGALIPLCLRGR 389

  Fly   366 IRHGRHFTFKA--QHLALTLVAESVTGSAVTVNEPYGVLGYWIQ--------------------- 407
            :.||||||:|:  ..:|:|.|:..|.|:..|...||...|.|:|                     
Human   390 LLHGRHFTYKSITGDMAITFVSTGVEGAFATEEHPYAAHGPWLQRPPSCELPSRPVCSPSCVHSF 454

  Fly   408 ---------------------VLIPDELVPRLMEDFRSAGLDEKCEPKE-RL--ELEWPDKNLK- 447
                                 :|:.:|.|.:::||     |::...|:| :|  |..||:|.|| 
Human   455 LVISQRGNFCSWQLTIPRGNLILLTEEFVEKMLED-----LEDLTSPEEFKLPKEYSWPEKKLKV 514

  Fly   448 -----LIIDQP 453
                 ::.|.|
Human   515 SILPDVVFDSP 525

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Su(fu)NP_536750.2 SUFU 52..236 CDD:282876 89/184 (48%)
SUFU_C 250..450 CDD:289253 61/292 (21%)
SUFUXP_011538160.1 SUFU 68..240 CDD:282876 89/184 (48%)
SUFU_C 254..516 CDD:289253 59/282 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C175965924
eggNOG 1 0.900 E1_28KPA
Hieranoid 1 1.000
Homologene 1 1.000 H9262
Inparanoid 1 1.050 303 1.000 Inparanoid score I2625
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1248959at2759
OrthoFinder 1 1.000 FOG0007903
OrthoInspector 1 1.000 T1074053
orthoMCL 1 0.900 OOG5_133643
Panther 1 1.100 LDO PTHR10928
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5422
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.