DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Su(fu) and Sufu

Sequence 1:NP_536750.2 Gene:Su(fu) FlyBaseID:FBgn0005355 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001020070.1 Gene:Sufu RGDID:1559462 Length:485 Species:Rattus norvegicus

Alignment Length:523 Identity:188/524 (36%)
Similarity:263/524 (50%) Gaps:110/524 (21%)


  Fly     1 MAEANLDKKPEVKP--------------------PPGLKAIIDHLGQVYPNQPNPLQVTTLLKYW 45
            |||.    :|.|.|                    ||||.||.....::||:||||||||.::|||
  Rat     1 MAEL----RPSVAPGPAAPPASGPSAPPAFASLFPPGLHAIYGECRRLYPDQPNPLQVTAIVKYW 61

  Fly    46 LGGQDPLDYISMYNYPGDVDRNVPPHWHYISFGLSDLHGDERVHLREEGVTRSGMGFELTFRLAK 110
            |||.|||||:|||...|....|:|.||||||||||||:||.|||........||.||||||||.:
  Rat    62 LGGPDPLDYVSMYRNMGSPSANIPEHWHYISFGLSDLYGDNRVHEFTGTDGPSGFGFELTFRLKR 126

  Fly   111 TEIELKQQIENPEKPQRPPTWPANLLQAIGRYCFQTGNGLCFGDNIPWRKSLDGSTTSKLQNLLV 175
            ...|           ..||||||.|:|.:.||.||:.|..|.||::.|...||.| .|::|::|:
  Rat   127 ETGE-----------SAPPTWPAELMQGLARYVFQSENTFCSGDHVSWHSPLDNS-ESRIQHMLL 179

  Fly   176 AQDPQLGCIDTPTGTVDFCQIVGVFDDELEQASRWNGRGVLNFLRQDMQTGGDWLVTNMDRQMSV 240
            .:|||:..:.||.|.|.|.|||||..:||..|.:|||:|:|..||.....||.||:|:|.|..::
  Rat   180 TEDPQMQPVQTPFGVVTFLQIVGVCTEELHSAQQWNGQGILELLRTVPIAGGPWLITDMRRGETI 244

  Fly   241 FELFPETLLNLQDD-----LEKQGSDLAGVNADFTFRELKPTKEVKEEVDFQALSEKCANDENNR 300
            ||:.|    :||.:     :|..||:|:||:|...:.:|....|               :||::|
  Rat   245 FEIDP----HLQQERVDKGIETDGSNLSGVSAKCAWDDLSRPPE---------------DDEDSR 290

  Fly   301 QL-----------TDTQMKRE----------EPSFPQSMSMSSNSL--------HKSCPLDFQ-A 335
            .:           .||:..||          :|..|...|...|.|        ..|...|.. |
  Rat   291 SICLGTQPRRLSGKDTEQIRETLRRGLEINSKPVLPPINSQRQNGLTYDRAPSRKDSLGSDISTA 355

  Fly   336 QAPNCI----SLDGIEITLAPGVAKYLLLAIKDRIRHGRHFTFKA--QHLALTLVAESVTGSAVT 394
            ..|:.:    .|:.:.:.........:.|.::.|:.||||||:|:  ..:|:|.|:..|.|:..|
  Rat   356 VIPHELIRTRQLESVHLKFNQESGALIPLCLRGRLLHGRHFTYKSITGDMAITFVSTGVEGAFAT 420

  Fly   395 VNEPYGVLGYWIQVLIPDELVPRLMEDFRSAGLDEKCEPKE-RL--ELEWPDKNLK------LII 450
            ...||...|.|:|:|:.:|.|.:::||     |::...|:| :|  |..||:|.||      ::.
  Rat   421 EEHPYAAHGPWLQILLTEEFVEKMLED-----LEDLTSPEEFKLPKEYSWPEKKLKVSILPDVVF 480

  Fly   451 DQP 453
            |.|
  Rat   481 DSP 483

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Su(fu)NP_536750.2 SUFU 52..236 CDD:282876 89/184 (48%)
SUFU_C 250..450 CDD:289253 63/250 (25%)
SufuNP_001020070.1 SUFU 68..240 CDD:282876 89/184 (48%)
SUFU_C 254..474 CDD:289253 61/240 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C175968357
eggNOG 1 0.900 E1_28KPA
Hieranoid 1 1.000
Homologene 1 1.000 H9262
Inparanoid 1 1.050 300 1.000 Inparanoid score I2566
OMA 1 1.010
OrthoDB 1 1.010 D1248959at2759
OrthoFinder 1 1.000 FOG0007903
OrthoInspector 1 1.000 T1087697
orthoMCL 1 0.900 OOG5_133643
Panther 1 1.100 LDO PTHR10928
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.