DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp313a4 and cyp19a1

Sequence 1:NP_650224.3 Gene:Cyp313a4 FlyBaseID:FBgn0038076 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001090630.1 Gene:cyp19a1 XenbaseID:XB-GENE-953895 Length:500 Species:Xenopus tropicalis

Alignment Length:506 Identity:121/507 (24%)
Similarity:212/507 (42%) Gaps:69/507 (14%)


  Fly    10 LLFLLWIYFLWSRRRFYLLTLKIPGP-----LGYPILGMAHWLMRREDILNAFGCFLDKHGPTIF 69
            |||:..:..||::..    |..||||     || |::....:|:  ..|..|...:.:.:|..:.
 Frog    27 LLFIFLLIILWNQEE----TCLIPGPAYCMGLG-PLISYGRFLL--TGIGKAANYYNNMYGEFVR 84

  Fly    70 SWLGPIPFMIVSDPQVVQDIFTSPHCVNKGIIYKAVDDGAGVGL-----------FSLKDPRWSI 123
            .|:.....:::|.......|....|.:::        .|:.:||           |:.....|.:
 Frog    85 VWINGEETLVISKASATFHIMKHSHYISR--------FGSKLGLQCIGMNENGIIFNSNPSLWKV 141

  Fly   124 HRKLLNPAFGHKVLLSFLPIFNRETALLLDQLEPLQDD-GEKDLIPLLQSFTLGIATQTTMGSDV 187
            .|.....|.....|:....|..|.|...||.|..:.:: |..|::.|::...|..:....:...:
 Frog   142 IRPFFIKALSGPGLMQTTEICIRSTKRYLDNLGNVTNELGNVDVLKLMRLIMLDTSNNLFLRIPL 206

  Fly   188 KDEE-SFRSNSLLGRYQCILETMTDMCFS-PWLNSRFCRQLAGKESHYYQAKTEIRQFIRKIIER 250
            .:.| ..:.......:|.:| ...|:.|. .||..:           |.::..::::.|..:||:
 Frog   207 DENEIVLKIQKYFDAWQALL-LKPDIFFKISWLYKK-----------YEKSANDLKEAIEILIEQ 259

  Fly   251 KLAEDEMGALPSIQSNDKNL-FLNLVTDLMRRGVFTLKNVEDESNIIVFGAFETTANAVYYTLML 314
            |..:     |.|.:..|:|: |.:.:......|..|.:||......::..|.:|.:.::::.|:|
 Frog   260 KRQK-----LSSSEKLDENMDFASELIFAQNHGDLTAENVNQCILEMLIAAPDTMSVSLFFMLVL 319

  Fly   315 LAMFPEYQERAFEEIKTIFPNTGDFDVSYADTQQMVYLDLILNESMRVIPPVPVVSRQTSQDLKL 379
            :|..|:.:|....||..:.   ||.||...|...:..|:..:.||||..|.|.:|.|:..:| .:
 Frog   320 VAQHPKIEEGIMNEIDNVI---GDRDVESNDIPNLKVLENFIYESMRYQPVVDLVMRKALED-DM 380

  Fly   380 SNGIVVPKGVQIAIDIYHMHRSKKIWGPDAETF-NPDHFLPHNIQDKHPYAYI-PFTKGIRNCIG 442
            .:|..|.||..|.:::..|||        .|.| .|:.|...|.:...||.|. ||..|.|.|.|
 Frog   381 IDGYYVKKGTNIILNLGRMHR--------IEYFPKPNEFTLENFEKTVPYRYFQPFGSGPRACAG 437

  Fly   443 WRYALISAKVTLAKLLRNYRFKT--SFPFENLYFVEDITMKL-KSVPLLEL 490
            ...|::..||.|..|.:.|:.:|  ....||:....|::|.. :|.|.||:
 Frog   438 KYIAMVMMKVILVTLFKRYKVQTLGGRCLENIQNNNDLSMHPDESQPCLEM 488

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp313a4NP_650224.3 p450 33..465 CDD:299894 105/454 (23%)
cyp19a1NP_001090630.1 p450 46..486 CDD:278495 112/480 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.