DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18549 and srw-40

DIOPT Version :9

Sequence 1:NP_650203.3 Gene:CG18549 / 41538 FlyBaseID:FBgn0038053 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_001364687.1 Gene:srw-40 / 190189 WormBaseID:WBGene00005787 Length:363 Species:Caenorhabditis elegans


Alignment Length:260 Identity:55/260 - (21%)
Similarity:88/260 - (33%) Gaps:84/260 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DTFKGEGYTSLAIIYLFFSLSNWLAPSFISFTGPRVAMVVGALTYTAFMITFMFPSTVLLYVGS- 104
            :.|..|.......|||......:.| .|:|||          :.:..|     |.:.|.|.:.| 
 Worm    13 ENFSEESRNFWVFIYLKVRCIRFYA-DFVSFT----------ICFVGF-----FANIVHLIILSQ 61

  Fly   105 -AVLGLGASITWTGQGTYLARCSESSTISRNSGVFWALLQCSMFIGNLFVYYQFQDKTRIDKET- 167
             ::..|..::.:.|    :|.|   .||.       .||....||  ::.||.||.....:|.| 
 Worm    62 KSMRNLSVNVFFIG----IAIC---DTIR-------LLLIIISFI--IYFYYIFQASFIHEKCTS 110

  Fly   168 ----------------RNLVIGVLTVIAVLGIVFLAALRFMADNAEHDNELEQKHTGCGQAIYAL 216
                            |||:...:...:::|:.....:|:..:                :.:.:|
 Worm   111 PTSHSMLLLAVLSSSIRNLLKISMWFASIMGVFRALFIRYPFN----------------KIVISL 159

  Fly   217 KSAGQLFLTKKML-LLSLAFFYTGLELSFFSGVFGSAIGFTTKIAETPKEIVGLVGICIGAGEVF 280
            .:......|..:: ||.|.|:||    ||.            ||.|.||.|......|.|..:.|
 Worm   160 MTIKNSIRTSILITLLILPFWYT----SFI------------KIRENPKWIWKPPSDCPGFSKNF 208

  Fly   281  280
             Worm   209  208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18549NP_650203.3 MFS_MFSD11 8..423 CDD:340965 55/260 (21%)
srw-40NP_001364687.1 7TM_GPCR_Srw 39..346 CDD:402097 49/233 (21%)
TM helix 1 39..62 CDD:410628 9/37 (24%)
TM helix 2 69..94 CDD:410628 9/40 (23%)
TM helix 3 120..149 CDD:410628 4/28 (14%)
TM helix 4 163..179 CDD:410628 4/15 (27%)
TM helix 5 216..241 CDD:410628
TM helix 6 263..293 CDD:410628
TM helix 7 307..332 CDD:410628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3098
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.