Sequence 1: | NP_650203.3 | Gene: | CG18549 / 41538 | FlyBaseID: | FBgn0038053 | Length: | 436 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001364687.1 | Gene: | srw-40 / 190189 | WormBaseID: | WBGene00005787 | Length: | 363 | Species: | Caenorhabditis elegans |
Alignment Length: | 260 | Identity: | 55/260 - (21%) |
---|---|---|---|
Similarity: | 88/260 - (33%) | Gaps: | 84/260 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 DTFKGEGYTSLAIIYLFFSLSNWLAPSFISFTGPRVAMVVGALTYTAFMITFMFPSTVLLYVGS- 104
Fly 105 -AVLGLGASITWTGQGTYLARCSESSTISRNSGVFWALLQCSMFIGNLFVYYQFQDKTRIDKET- 167
Fly 168 ----------------RNLVIGVLTVIAVLGIVFLAALRFMADNAEHDNELEQKHTGCGQAIYAL 216
Fly 217 KSAGQLFLTKKML-LLSLAFFYTGLELSFFSGVFGSAIGFTTKIAETPKEIVGLVGICIGAGEVF 280
Fly 281 280 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18549 | NP_650203.3 | MFS_MFSD11 | 8..423 | CDD:340965 | 55/260 (21%) |
srw-40 | NP_001364687.1 | 7TM_GPCR_Srw | 39..346 | CDD:402097 | 49/233 (21%) |
TM helix 1 | 39..62 | CDD:410628 | 9/37 (24%) | ||
TM helix 2 | 69..94 | CDD:410628 | 9/40 (23%) | ||
TM helix 3 | 120..149 | CDD:410628 | 4/28 (14%) | ||
TM helix 4 | 163..179 | CDD:410628 | 4/15 (27%) | ||
TM helix 5 | 216..241 | CDD:410628 | |||
TM helix 6 | 263..293 | CDD:410628 | |||
TM helix 7 | 307..332 | CDD:410628 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3098 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |