| Sequence 1: | NP_650203.3 | Gene: | CG18549 / 41538 | FlyBaseID: | FBgn0038053 | Length: | 436 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001364687.1 | Gene: | srw-40 / 190189 | WormBaseID: | WBGene00005787 | Length: | 363 | Species: | Caenorhabditis elegans |
| Alignment Length: | 260 | Identity: | 55/260 - (21%) |
|---|---|---|---|
| Similarity: | 88/260 - (33%) | Gaps: | 84/260 - (32%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 41 DTFKGEGYTSLAIIYLFFSLSNWLAPSFISFTGPRVAMVVGALTYTAFMITFMFPSTVLLYVGS- 104
Fly 105 -AVLGLGASITWTGQGTYLARCSESSTISRNSGVFWALLQCSMFIGNLFVYYQFQDKTRIDKET- 167
Fly 168 ----------------RNLVIGVLTVIAVLGIVFLAALRFMADNAEHDNELEQKHTGCGQAIYAL 216
Fly 217 KSAGQLFLTKKML-LLSLAFFYTGLELSFFSGVFGSAIGFTTKIAETPKEIVGLVGICIGAGEVF 280
Fly 281 280 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG18549 | NP_650203.3 | MFS_MFSD11 | 8..423 | CDD:340965 | 55/260 (21%) |
| srw-40 | NP_001364687.1 | 7TM_GPCR_Srw | 39..346 | CDD:402097 | 49/233 (21%) |
| TM helix 1 | 39..62 | CDD:410628 | 9/37 (24%) | ||
| TM helix 2 | 69..94 | CDD:410628 | 9/40 (23%) | ||
| TM helix 3 | 120..149 | CDD:410628 | 4/28 (14%) | ||
| TM helix 4 | 163..179 | CDD:410628 | 4/15 (27%) | ||
| TM helix 5 | 216..241 | CDD:410628 | |||
| TM helix 6 | 263..293 | CDD:410628 | |||
| TM helix 7 | 307..332 | CDD:410628 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3098 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||