DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18549 and srw-32

DIOPT Version :9

Sequence 1:NP_650203.3 Gene:CG18549 / 41538 FlyBaseID:FBgn0038053 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_507436.1 Gene:srw-32 / 186949 WormBaseID:WBGene00005779 Length:367 Species:Caenorhabditis elegans


Alignment Length:278 Identity:44/278 - (15%)
Similarity:92/278 - (33%) Gaps:77/278 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 MFVFTAFQTMCNIEKTILDSISQEDDTFKGEGYTSLAIIYLFFSLSNWLAPSFISFTGPRVAMVV 80
            :.:|..|..:..:...:.|....|..........|.:...:...:|.|||          ||:.|
 Worm    85 IIIFVPFFNLRYLSDKVSDCHDPESTVAVFSYNVSASFTRITEKISVWLA----------VAIAV 139

  Fly    81 GALTYTAFMIT--------FMFPSTVLLYVGSAVLGLGAS-------------------ITWTGQ 118
            .......:::.        ..:...::|.:...:|..|||                   ||::|.
 Worm   140 IRTLVMRYLVNGRINCWTDAKYGLKIVLLITLLILPFGASNYSKLSSTSVREWTPFTNCITFSGN 204

  Fly   119 GTYLARCSESSTISRNSGVFWALLQCSMFIGNLFVYYQFQDKTRIDKETRNLVIGVLTVIAVLGI 183
            .|.:.....|:.:..::.||    :.::.|..:|:.:           |.::::.:.|:..::.:
 Worm   205 STKIKFDFHSTELFGSTDVF----KIALLIEGIFLEF-----------TPSIILPITTISLIMDL 254

  Fly   184 VFLAALRFMADNAEHDNELEQKHTGCGQAIYALKSAGQLFLTKKMLLLSLAFFYTGLELSF--FS 246
                       .....|.|..|.        :|.|:..:...|.:..:::.|.:|...|.|  ..
 Worm   255 -----------RKARKNSLFTKS--------SLSSSDTVRSIKLVAFVTITFLFTTTPLGFMYIV 300

  Fly   247 GVF----GSAIGFTTKIA 260
            |:|    ...|...||.|
 Worm   301 GIFIVTMPGLIMLVTKFA 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18549NP_650203.3 MFS_MFSD11 8..423 CDD:340965 44/278 (16%)
srw-32NP_507436.1 7TM_GPCR_Srw 36..354 CDD:370978 44/278 (16%)
TM helix 2 66..91 CDD:341315 1/5 (20%)
TM helix 3 116..146 CDD:341315 8/39 (21%)
TM helix 4 166..191 CDD:341315 5/24 (21%)
TM helix 5 224..249 CDD:341315 5/39 (13%)
TM helix 6 271..302 CDD:341315 5/30 (17%)
TM helix 7 315..340 CDD:341315 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3098
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.