| Sequence 1: | NP_650203.3 | Gene: | CG18549 / 41538 | FlyBaseID: | FBgn0038053 | Length: | 436 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_506996.1 | Gene: | srw-59 / 186771 | WormBaseID: | WBGene00005806 | Length: | 349 | Species: | Caenorhabditis elegans | 
| Alignment Length: | 284 | Identity: | 58/284 - (20%) | 
|---|---|---|---|
| Similarity: | 105/284 - (36%) | Gaps: | 74/284 - (26%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    17 FVFTAFQTMCNIEKTILDSISQEDDTFKGEGYTSLAIIYLFFSLSNWLAPSFISFTGPRVAMVVG 81 
  Fly    82 ALTYTAFMITFMFPSTVLLYVGSAVLGLG-ASITWT--------GQGTYLARCSESSTISRNSGV 137 
  Fly   138 FWALLQCSMFIGNLFVYYQFQDKTRIDKETRNLVIGVLTVIAVLGIVFLAALRFMADNAEHDNEL 202 
  Fly   203 EQKHTGCGQAIYALKSAGQLFLTKKMLLLSLAFFYTGLE----LSFFSGVFGSAIGFTTKIAETP 263 
  Fly   264 KEIVGLVGICIGA------GEVFG 281 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG18549 | NP_650203.3 | MFS_MFSD11 | 8..423 | CDD:340965 | 58/284 (20%) | 
| srw-59 | NP_506996.1 | 7TM_GPCR_Srw | 31..340 | CDD:370978 | 58/284 (20%) | 
| TM helix 1 | 34..53 | CDD:320109 | |||
| TM helix 2 | 62..84 | CDD:320109 | |||
| TM helix 3 | 113..135 | CDD:320109 | 4/29 (14%) | ||
| TM helix 4 | 160..176 | CDD:320109 | 3/16 (19%) | ||
| TM helix 5 | 216..239 | CDD:320109 | 4/47 (9%) | ||
| TM helix 6 | 261..286 | CDD:320109 | 5/27 (19%) | ||
| TM helix 7 | 301..326 | CDD:320109 | 6/27 (22%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3098 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||