DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18549 and tspan12

DIOPT Version :9

Sequence 1:NP_650203.3 Gene:CG18549 / 41538 FlyBaseID:FBgn0038053 Length:436 Species:Drosophila melanogaster
Sequence 2:XP_004913041.1 Gene:tspan12 / 100487941 XenbaseID:XB-GENE-1011828 Length:304 Species:Xenopus tropicalis


Alignment Length:254 Identity:42/254 - (16%)
Similarity:81/254 - (31%) Gaps:95/254 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 TFKGEGYTSLAIIYLFFSLSNWLAPSFISFTGPRVAMVVGALTY------TAFMITFMFPSTVLL 100
            |...|.....|::..:|.:.:.:..:...|     .::||.|.|      ...::.:.|.|.:::
 Frog    44 TLTAETRVEEAVVLTYFPVFHPVMIAVCCF-----LIIVGMLGYCGTVKSNLILLLWYFGSLLII 103

  Fly   101 YVGSAVLGLGASITWTGQGTYLARCSESSTISRNSGVFWALLQCSM---------FIGNLFVYYQ 156
            :......|:     ||.:....|....|..::         |:..|         ::.|.:.::|
 Frog   104 FCIELSCGV-----WTYEQEITAPVQWSDMVT---------LKAKMPNYGFPRYQWLTNAWNFFQ 154

  Fly   157 FQDKTRIDKETRNLVIGVLTVIAVLGIVFLAALRFMAD------------------NAEHDNELE 203
            .:.|                   ..|:|:|.....|.:                  .|.|.:..:
 Frog   155 REFK-------------------CCGVVYLTDWLEMTEMDWPPDSCCVKEYPGCSKQAHHGDLSD 200

  Fly   204 QKHTGCGQAIYALKSAGQLFL--TKKMLLLSLAFFYTGLELSFFSGVFGSAIGFTTKIA 260
            ....|||:.:|:       ||  ||::.:|..               .|.|||.|..:|
 Frog   201 LYQEGCGRKMYS-------FLRGTKQLQVLRF---------------LGIAIGVTQILA 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18549NP_650203.3 MFS_MFSD11 8..423 CDD:340965 42/254 (17%)
tspan12XP_004913041.1 Tetraspannin 10..244 CDD:395265 42/254 (17%)
TM4SF12_like_LEL 116..218 CDD:239410 19/136 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54908
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.