DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Desat2 and ADS4

Sequence 1:NP_650201.1 Gene:Desat2 FlyBaseID:FBgn0043043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_172124.2 Gene:ADS4 AraportID:AT1G06350 Length:300 Species:Arabidopsis thaliana

Alignment Length:298 Identity:92/299 (31%)
Similarity:142/299 (47%) Gaps:34/299 (11%)


  Fly    40 KRAE-KRRLPLVWRNII---LFALVHLAALYGLHSIFTRAKLATTLFAAGLYIIGMLGVTAGAHR 100
            |||. :|:.|||  :::   :..:||...|....:.    |.....|...|:.:..|.:|...||
plant    21 KRAYFQRQWPLV--DVVRASVVVIVHFLCLLAPFNF----KWEALRFGLVLFALTTLSITFSFHR 79

  Fly   101 LWAHRTYK-AKWPLRLLLVIFNTIAFQDAVYHWARDHRVHHKYSETDADPHNATRGFFFSHVGWL 164
            ..:||::| .|| |..........|.|.....|...||.||:::::|.|||:...|..|||:.|:
plant    80 NLSHRSFKIPKW-LEYPWAYSAVFALQGDPMDWVSIHRFHHQFTDSDRDPHSPKEGLLFSHILWI 143

  Fly   165 LCKKHPDIKEKGRGLD-LSDLRADPILMFQRK--HYYILMPLACFVLPTVIPMVYWNETLASSWF 226
            ...::  ||.|..|.| :.||:......|.|:  ..:|||......|...:|.      |.....
plant   144 FDTQY--IKYKCGGRDNVLDLKKQWFYKFLRRTIAVHILMFWTILYLYGGLPY------LTCGGG 200

  Fly   227 VATMFRWCFQLNMTWLVNSAAHKFGNRPYDKTMNPTQNA-FVSAFTFGEGWHNYHHAFPWDYKTA 290
            |.....:    ::|||||||.|.:|:|.:: |.:.::|. ::|.||.||.|||.||||....:..
plant   201 VGIFIGY----HVTWLVNSACHIWGSRSWN-TKDTSRNVWWLSLFTMGESWHNNHHAFESSARQG 260

  Fly   291 -EWGCYSLNITTAFIDLFAKIGWAYDLKTVAPDVIQRR 327
             ||  :.::||...|.||..:|.|.|:|  .|..:|::
plant   261 LEW--WQIDITWYLIRLFEVLGIATDVK--LPSELQKQ 294

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Desat2NP_650201.1 Delta9-FADS-like 76..317 CDD:239582 79/247 (32%)
FA_desaturase 81..284 CDD:278890 68/208 (33%)
ADS4NP_172124.2 PLN02220 1..300 CDD:177866 92/299 (31%)
FA_desaturase 58..274 CDD:278890 73/232 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1756
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D971318at2759
OrthoInspector 1 1.000 T32177
orthoMCL 1 0.900 OOG5_126939
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.