DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Desat2 and ADS4

DIOPT Version :10

Sequence 1:NP_650201.1 Gene:Desat2 / 41536 FlyBaseID:FBgn0043043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_172124.2 Gene:ADS4 / 837146 AraportID:AT1G06350 Length:300 Species:Arabidopsis thaliana


Alignment Length:57 Identity:17/57 - (29%)
Similarity:25/57 - (43%) Gaps:8/57 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SLRIQRLVDCQHFH-----YSSVELGPVRVAIIAINADENATERIKMRV-ESESNSW 74
            |||.:..|.|:..|     ::|..||  .:||:|...|.|........: :|.|..|
plant   164 SLRSRCWVKCEGMHRPRCLFASGSLG--GIAIVAGGTDMNGNILASAELYDSSSGRW 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Desat2NP_650201.1 OLE1 41..326 CDD:441008 10/35 (29%)
ADS4NP_172124.2 PLN02220 1..300 CDD:177866 17/57 (30%)

Return to query results.
Submit another query.