DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Desat2 and Scd4

Sequence 1:NP_650201.1 Gene:Desat2 FlyBaseID:FBgn0043043 Length:361 Species:Drosophila melanogaster
Sequence 2:XP_001057317.5 Gene:Scd4 RGDID:1563648 Length:353 Species:Rattus norvegicus

Alignment Length:331 Identity:170/332 (51%)
Similarity:226/332 (68%) Gaps:7/332 (2%)


  Fly     9 HQDKSSRETGVLF--EDDAQTVDGDLTTDRFQLKRAEKRRLPLVWRNIILFALVHLAALYGLHSI 71
            |||  ..|| :.|  ||....:..|:....:|.:.....:|..||||||..||:|:.||||: ::
  Rat    26 HQD--GEET-IPFQSEDIRPEMREDIHDPSYQDEEGPPPKLEYVWRNIIFMALLHVGALYGI-TL 86

  Fly    72 FTRAKLATTLFAAGLYIIGMLGVTAGAHRLWAHRTYKAKWPLRLLLVIFNTIAFQDAVYHWARDH 136
            ....|:.|.|......|:..||:||||||||:||||||:.||||.|::.||:|||:.||.|||||
  Rat    87 VPSCKVYTWLLGIFYNIVAGLGITAGAHRLWSHRTYKARLPLRLFLIMANTMAFQNDVYEWARDH 151

  Fly   137 RVHHKYSETDADPHNATRGFFFSHVGWLLCKKHPDIKEKGRGLDLSDLRADPILMFQRKHYYILM 201
            |.|||:|||.|||||:.||||||||||||.:|||.:||||..||:|||:|:.::||||::|.:.:
  Rat   152 RAHHKFSETHADPHNSRRGFFFSHVGWLLVRKHPAVKEKGGKLDMSDLKAEKLVMFQRRYYKLAV 216

  Fly   202 PLACFVLPTVIPMVYWNETLASSWFVATMFRWCFQLNMTWLVNSAAHKFGNRPYDKTMNPTQNAF 266
            .|....|||::|..:|.|||..|..|:|..|:...||.|||||||||.:|::|||:::...:|..
  Rat   217 TLIFITLPTMVPWYFWGETLRHSLCVSTFLRYAVLLNFTWLVNSAAHLYGHQPYDRSIGARENPL 281

  Fly   267 VSAFTFGEGWHNYHHAFPWDYKTAEWGCYSLNITTAFIDLFAKIGWAYDLKTVAPDVIQRRVLRT 331
            ||..:.|||:||||||||:||..:|:. :.:|.||.|||..|.:|.|||.|.|:...:..||.||
  Rat   282 VSVASLGEGFHNYHHAFPYDYSVSEYR-WHINFTTFFIDCMAALGLAYDRKRVSKAAVLARVKRT 345

  Fly   332 GDGSHE 337
            |||||:
  Rat   346 GDGSHK 351

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Desat2NP_650201.1 Delta9-FADS-like 76..317 CDD:239582 135/241 (56%)
FA_desaturase 81..284 CDD:278890 118/203 (58%)
Scd4XP_001057317.5 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C106205229
eggNOG 1 0.900 E1_COG1398
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 366 1.000 Inparanoid score I2063
OMA 1 1.010
OrthoDB 1 1.010 D296120at33208
OrthoFinder 1 1.000 FOG0000495
OrthoInspector 1 1.000 T131218
orthoMCL 1 0.900 OOG5_126939
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
TreeFam 1 0.960
1110.670

Return to query results.
Submit another query.