DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Desat2 and Fad2

Sequence 1:NP_650201.1 Gene:Desat2 FlyBaseID:FBgn0043043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_651966.2 Gene:Fad2 FlyBaseID:FBgn0029172 Length:355 Species:Drosophila melanogaster

Alignment Length:334 Identity:190/335 (57%)
Similarity:253/335 (76%) Gaps:0/335 (0%)


  Fly    17 TGVLFEDDAQTVDGDLTTDRFQLKRAEKRRLPLVWRNIILFALVHLAALYGLHSIFTRAKLATTL 81
            ||||:|.|.:||||.|:|:....|..:..:|.|||.||:||.::|:::|||:..:||.|...|.:
  Fly     9 TGVLYESDVETVDGGLSTELSNRKTTDGSKLELVWVNIVLFVILHISSLYGVWLLFTSATWTTVV 73

  Fly    82 FAAGLYIIGMLGVTAGAHRLWAHRTYKAKWPLRLLLVIFNTIAFQDAVYHWARDHRVHHKYSETD 146
            ......::.:|||:.||||||||||:||..||:|:.:..||:|||||||:|||||||||||:|||
  Fly    74 LFWPTVVVTILGVSGGAHRLWAHRTFKANTPLKLIFLFLNTLAFQDAVYYWARDHRVHHKYTETD 138

  Fly   147 ADPHNATRGFFFSHVGWLLCKKHPDIKEKGRGLDLSDLRADPILMFQRKHYYILMPLACFVLPTV 211
            |||:|:.||:||:|:|||.|:|||::.|||:.:|||||.|||::|||:|:|.:|||:.|||||||
  Fly   139 ADPYNSQRGWFFAHIGWLCCRKHPEVVEKGKQIDLSDLEADPLIMFQKKYYLLLMPIICFVLPTV 203

  Fly   212 IPMVYWNETLASSWFVATMFRWCFQLNMTWLVNSAAHKFGNRPYDKTMNPTQNAFVSAFTFGEGW 276
            :||..|.|:|..||.|..:.|||..||:.|.|||:||..|.|||||.:.|....|:..|..|||:
  Fly   204 LPMYLWGESLNVSWHVMALLRWCLSLNLIWTVNSSAHMHGMRPYDKNICPVDQGFLIFFRVGEGY 268

  Fly   277 HNYHHAFPWDYKTAEWGCYSLNITTAFIDLFAKIGWAYDLKTVAPDVIQRRVLRTGDGSHELWGW 341
            |||||.||||||:||.|.||.::||.||:..|.:|||||||:|:.|::::||.|:|||||.:|||
  Fly   269 HNYHHVFPWDYKSAELGKYSQDVTTKFIEFMAYLGWAYDLKSVSLDLVKQRVQRSGDGSHPVWGW 333

  Fly   342 GDKDLTAED 350
            ||||...||
  Fly   334 GDKDQLKED 342

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Desat2NP_650201.1 Delta9-FADS-like 76..317 CDD:239582 142/241 (59%)
FA_desaturase 81..284 CDD:278890 120/203 (59%)
Fad2NP_651966.2 Delta9-FADS-like 68..309 CDD:239582 142/241 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131040901
eggNOG 1 0.900 E1_COG1398
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1756
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D296120at33208
OrthoFinder 1 1.000 FOG0000495
orthoMCL 1 0.900 OOG5_126939
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.