DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prosalpha2 and AT1G79210

Sequence 1:NP_524328.1 Gene:Prosalpha2 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001077845.1 Gene:AT1G79210 AraportID:AT1G79210 Length:235 Species:Arabidopsis thaliana

Alignment Length:234 Identity:151/235 (64%)
Similarity:187/235 (80%) Gaps:1/235 (0%)


  Fly     1 MATERYSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRV 65
            |...:||||||||||||||||:|:||.||..|..|:||.||||||||||.|..|.|.::.||.::
plant     1 MGDSQYSFSLTTFSPSGKLVQIEHALTAVGSGQTSLGIKASNGVVIATEKKLPSILVDEASVQKI 65

  Fly    66 EMIYNHIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPF 130
            :.:..:||.||||||||:|:||:::||.|:.|...|||||||:|||:..||:|||:|||||||||
plant    66 QHLTPNIGTVYSGMGPDFRVLVRKSRKQAEQYLRLYKEPIPVTQLVRETATVMQEFTQSGGVRPF 130

  Fly   131 GVSLLICGWDNDRPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDDAVHTAILTL 195
            |||||:.|:|:..|.|||.||||:||:|||:|||||..|.||||||||:||:|||||:|||||||
plant   131 GVSLLVAGYDDKGPQLYQVDPSGSYFSWKASAMGKNVSNAKTFLEKRYTEDMELDDAIHTAILTL 195

  Fly   196 KEGFEGKMTADNIEIG-ICDQNGFQRLDPASIKDYLASI 233
            ||||||::::.||||| |.....|:.|.||.|.||||.:
plant   196 KEGFEGEISSKNIEIGKIGTDKVFRVLTPAEIDDYLAEV 234

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 PRK03996 6..233 CDD:235192 150/228 (66%)
proteasome_alpha_type_2 6..231 CDD:239719 149/226 (66%)
AT1G79210NP_001077845.1 PRK03996 6..235 CDD:235192 150/230 (65%)
proteasome_alpha_type_2 6..232 CDD:239719 149/226 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H2081
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1222564at2759
OrthoInspector 1 1.000 T125198
orthoMCL 1 0.900 OOG5_127791
Panther 1 1.100 LDO PTHR11599
Phylome 1 0.910 0.667 Consistency score
87.930

Return to query results.
Submit another query.