DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha2 and Psma8

DIOPT Version :9

Sequence 1:NP_524328.1 Gene:Prosalpha2 / 41531 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001157081.1 Gene:Psma8 / 73677 MGIID:1920927 Length:250 Species:Mus musculus


Alignment Length:229 Identity:95/229 - (41%)
Similarity:143/229 - (62%) Gaps:11/229 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RYSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRVEMIY 69
            ||..::|.|||.|.|.|:|||..||..|:.:|||..:|.||:..|.|..:.|.::.:|.::..:.
Mouse     4 RYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGVEKKSVAKLQDERTVRKICALD 68

  Fly    70 NHIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVSL 134
            :|:.|.::|:..|.|:::.:||...|::.||.::|:.|..:.:.:|||.|:||||.|.||||:|.
Mouse    69 DHVCMAFAGLTADARVVISRARVECQSHKLTVEDPVTVEYITRFIATLKQKYTQSNGRRPFGISA 133

  Fly   135 LICGWDNDR-PYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDD--AVHTAILTLK 196
            ||.|:|:|. |.|||:||||.|.||||.|:|::|...:.||||.|:||...:|  |:..||..|.
Mouse   134 LIVGFDDDGIPRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTEDAISNDKEAIKLAIKALL 198

  Fly   197 EGFE--GKMTADNIEIGICDQNGFQRLDPASIKD 228
            |..:  ||    |||:.|..::  |.|...|.|:
Mouse   199 EVVQSGGK----NIELAIIRRD--QPLKMFSAKE 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 proteasome_alpha_type_2 6..231 CDD:239719 94/228 (41%)
Psma8NP_001157081.1 PRK03996 5..235 CDD:235192 94/228 (41%)
proteasome_alpha_type_7 5..213 CDD:239724 89/211 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.