DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prosalpha2 and psma2

Sequence 1:NP_524328.1 Gene:Prosalpha2 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001016382.1 Gene:psma2 XenbaseID:XB-GENE-964711 Length:234 Species:Xenopus tropicalis

Alignment Length:233 Identity:182/234 (78%)
Similarity:208/234 (89%) Gaps:0/234 (0%)


  Fly     1 MATERYSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRV 65
            ||...||||||||||||||||:|||||||:.|||||||.|:||||:|||.|.||.||::.|.|:|
 Frog     1 MAERGYSFSLTTFSPSGKLVQIEYALAAVAAGAPSVGIKATNGVVLATEKKQKSILYDEQSAHKV 65

  Fly    66 EMIYNHIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPF 130
            |.|..||||||||||||||:||::|||:||.|||.|:||||.:|||||||::|||||||||||||
 Frog    66 EPITKHIGMVYSGMGPDYRVLVRRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPF 130

  Fly   131 GVSLLICGWDNDRPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDDAVHTAILTL 195
            ||||||.|||..||||:|||||||||||||||||||.|||||||||||:|||||:||:|||||||
 Frog   131 GVSLLIAGWDEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTL 195

  Fly   196 KEGFEGKMTADNIEIGICDQNGFQRLDPASIKDYLASI 233
            ||.|||:||.||||:|||::.||:||.||.:|||||:|
 Frog   196 KESFEGQMTEDNIEVGICNEAGFKRLTPAEVKDYLAAI 233

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 PRK03996 6..233 CDD:235192 179/227 (79%)
proteasome_alpha_type_2 6..231 CDD:239719 178/225 (79%)
psma2NP_001016382.1 PRK03996 5..233 CDD:235192 179/228 (79%)
proteasome_alpha_type_2 6..231 CDD:239719 178/225 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C273164259
eggNOG 1 0.900 E1_KOG0181
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H2081
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1222564at2759
OrthoFinder 1 1.000 FOG0003366
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.