DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prosalpha2 and RGD1562029

Sequence 1:NP_524328.1 Gene:Prosalpha2 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:XP_017452300.1 Gene:RGD1562029 RGDID:1562029 Length:1153 Species:Rattus norvegicus

Alignment Length:121 Identity:27/122 (22%)
Similarity:41/122 (34%) Gaps:29/122 (24%)


  Fly    25 ALAAVSGGAP-----------------SVGIIASNGVVIATENKH--KSPLYEQHS---VHRVEM 67
            |.||.|.|||                 :.|:|.||.....|...|  .:|..::..   .:|.|.
  Rat   584 AEAAESQGAPQSLEAAAQKTGEPQSCINKGLICSNEKEFYTRKLHIDMTPFLKERGDELAYREEA 648

  Fly    68 IYNHIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQ 123
            ...|.|.|....|       |....:|...:....:|.|.:...:.::|.:.|..|
  Rat   649 GGPHRGNVEGSQG-------KIPGSLADGGFSVLTDPEPRNVTFEPLSTSLAEDNQ 697

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 PRK03996 6..233 CDD:235192 27/122 (22%)
proteasome_alpha_type_2 6..231 CDD:239719 27/122 (22%)
RGD1562029XP_017452300.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0181
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.