DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prosalpha2 and Prosalpha1

Sequence 1:NP_524328.1 Gene:Prosalpha2 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_524837.2 Gene:Prosalpha1 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster

Alignment Length:228 Identity:70/229 (31%)
Similarity:121/229 (53%) Gaps:4/229 (2%)


  Fly    10 LTTFSPSGKLVQLEYALAAVS-GGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRVEMIYNHIG 73
            :|.|||.|:|.|:|||..|:: ....:|.:.:.:..|:||:.|.........:|..:..|...||
  Fly    13 ITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETVTHLFRITKDIG 77

  Fly    74 MVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVSLLICG 138
            ...:|...|.|..|::||..|..:...|...:||..|.:|:|.:.|.|||:..:||.|.|:::..
  Fly    78 CAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLGCSMVLIA 142

  Fly   139 WDND-RPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDDAVHTAILTLKEGFEGK 202
            :||: .|.:|::||:|.:..:||.::|...:...::|||:|..:|..:.|:..||..|.......
  Fly   143 YDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAISCLSSVLAID 207

  Fly   203 MTADNIEIGICDQNG--FQRLDPASIKDYLASI 233
            ...:.||||:..::.  |:.||...|:::|..|
  Fly   208 FKPNGIEIGVVSKSDPTFRILDEREIEEHLTKI 240

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 PRK03996 6..233 CDD:235192 69/227 (30%)
proteasome_alpha_type_2 6..231 CDD:239719 69/225 (31%)
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 70/229 (31%)
proteasome_alpha_type_6 8..218 CDD:239723 64/205 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C78965338
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11599
RoundUp 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.