DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prosalpha2 and si:rp71-45k5.4

Sequence 1:NP_524328.1 Gene:Prosalpha2 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001122146.1 Gene:si:rp71-45k5.4 ZFINID:ZDB-GENE-060503-941 Length:234 Species:Danio rerio

Alignment Length:233 Identity:184/234 (79%)
Similarity:209/234 (89%) Gaps:0/234 (0%)


  Fly     1 MATERYSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRV 65
            ||...||||||||||||||||:|||||||:.|||||||.||||||:|||.|.||.||::.|||:|
Zfish     1 MAERGYSFSLTTFSPSGKLVQIEYALAAVAAGAPSVGIKASNGVVLATEKKQKSILYDEQSVHKV 65

  Fly    66 EMIYNHIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPF 130
            |.|..||||||||||||||:||::|||:||.|:|.|:||||..|||||||::|||||||||||||
Zfish    66 EPITKHIGMVYSGMGPDYRVLVRRARKLAQQYFLVYQEPIPTGQLVQRVASVMQEYTQSGGVRPF 130

  Fly   131 GVSLLICGWDNDRPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDDAVHTAILTL 195
            ||||||.|||.|||||:|||||||||||||||||||.|||||||||||:|||||:||:|||||||
Zfish   131 GVSLLIAGWDEDRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTL 195

  Fly   196 KEGFEGKMTADNIEIGICDQNGFQRLDPASIKDYLASI 233
            ||.|||:||.||||:|||::.||:||.||.:|||||:|
Zfish   196 KESFEGQMTEDNIEVGICNEAGFRRLSPAEVKDYLAAI 233

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 PRK03996 6..233 CDD:235192 181/227 (80%)
proteasome_alpha_type_2 6..231 CDD:239719 180/225 (80%)
si:rp71-45k5.4NP_001122146.1 PRK03996 5..233 CDD:235192 181/228 (79%)
proteasome_alpha_type_2 6..231 CDD:239719 180/225 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C273164225
eggNOG 1 0.900 E1_KOG0181
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H2081
Inparanoid 1 1.050 381 1.000 Inparanoid score I1970
OMA 1 1.010
OrthoDB 1 1.010 D1222564at2759
OrthoFinder 1 1.000 FOG0003366
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR11599
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1004
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.