DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prosalpha2 and psma7

Sequence 1:NP_524328.1 Gene:Prosalpha2 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_989071.1 Gene:psma7 XenbaseID:XB-GENE-974596 Length:248 Species:Xenopus tropicalis

Alignment Length:236 Identity:89/237 (38%)
Similarity:140/237 (59%) Gaps:14/237 (6%)


  Fly     6 YSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRVEMIYN 70
            |..::|.|||.|.|.|:|||..||..|:.:||:.....||:..|.|..:.|.::.:|.::..:..
 Frog     3 YDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGKEIVVLGVEKKSVAKLQDERTVRKICALDE 67

  Fly    71 HIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVSLL 135
            ::.|.::|:..|.|:::.:||...|::.||.::|:.|..:.:.:|:|.|.||||.|.||||:|.|
 Frog    68 NVFMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISAL 132

  Fly   136 ICGWDND-RPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDDAVHTAILTLKEGF 199
            |.|:|.| .|.|||:||||.|.||||.|:|:.|.:.:.||||.|:     |:|:.|..||:|...
 Frog   133 IVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKHYT-----DEAIETDDLTIKLVI 192

  Fly   200 EGKMT-----ADNIEIGIC--DQNGFQRLDPASIKDYLASI 233
            :..:.     ..|||:.:.  || ..:.|:|..|:.|:|.|
 Frog   193 KALLEVVQSGGKNIELAVMRRDQ-PLKILNPEEIERYVAEI 232

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 PRK03996 6..233 CDD:235192 88/235 (37%)
proteasome_alpha_type_2 6..231 CDD:239719 87/233 (37%)
psma7NP_989071.1 proteasome_alpha_type_7 3..211 CDD:239724 81/213 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.