DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prosalpha2 and Prosalpha4T2

Sequence 1:NP_524328.1 Gene:Prosalpha2 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001286844.1 Gene:Prosalpha4T2 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster

Alignment Length:196 Identity:72/197 (37%)
Similarity:121/197 (61%) Gaps:4/197 (2%)


  Fly     4 ERYSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRVEMI 68
            :||..::|.:||.|.|:|:|||..||..|:..:|:..:|.:||..|.:....|.|:..|.::.|:
  Fly     3 QRYDRAVTIYSPDGHLLQVEYAQEAVRRGSTVMGLRTNNAIVIGVEKRSVGDLQEERMVRKICML 67

  Fly    69 YNHIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVS 133
            .:|:.|.:||:..|.|:||.:|:..||::.|.:::|..|..:.:.:|.|.|.||||.|.||||:|
  Fly    68 DDHVVMTFSGLTADARILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPFGLS 132

  Fly   134 LLICGWDND-RPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDD---AVHTAILT 194
            .|:.|:|.| .|:|:|:||||.::.|:|...|:::...:.::||...|.|.:.|   |:...:.|
  Fly   133 CLVGGFDEDGTPHLFQTDPSGIFYEWRANTTGRSSQPVRDYMEKHADEILTIADEAAAIKHIVRT 197

  Fly   195 L 195
            |
  Fly   198 L 198

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 PRK03996 6..233 CDD:235192 71/195 (36%)
proteasome_alpha_type_2 6..231 CDD:239719 71/195 (36%)
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 71/195 (36%)
Ntn_hydrolase 5..214 CDD:294319 71/195 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C78938440
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11599
RoundUp 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.