DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prosalpha2 and Prosalpha5

Sequence 1:NP_524328.1 Gene:Prosalpha2 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_477202.2 Gene:Prosalpha5 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster

Alignment Length:217 Identity:72/218 (33%)
Similarity:118/218 (54%) Gaps:7/218 (3%)


  Fly     1 MATERYSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRV 65
            :....|...:.||||.|:|.|:|||:.|:..|:.::||....|||:|.|.:..|||....:|.::
  Fly     3 LTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGICTPEGVVLAVEKRITSPLMVPSTVEKI 67

  Fly    66 EMIYNHIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGG---- 126
            ..:..|||...||:..|.|.|:::||...|.::..|.|.:.:....|.|:||..::..||.    
  Fly    68 VEVDKHIGCATSGLMADARTLIERARVECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGA 132

  Fly   127 ---VRPFGVSLLICGWDNDRPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDDAV 188
               .|||||::|..|.:..:|.|:..||||.:....|.|:|..:...:..|:..:..||.||:|:
  Fly   133 AAMSRPFGVAILFAGIEAGQPQLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAI 197

  Fly   189 HTAILTLKEGFEGKMTADNIEI 210
            ..::.|||:..|.|:.:.|:|:
  Fly   198 DISLNTLKQVMEEKLNSTNVEV 219

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 PRK03996 6..233 CDD:235192 72/213 (34%)
proteasome_alpha_type_2 6..231 CDD:239719 72/213 (34%)
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 72/213 (34%)
proteasome_alpha_type_5 8..222 CDD:239722 72/213 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C78886277
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11599
RoundUp 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.