DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prosalpha2 and Psma8

Sequence 1:NP_524328.1 Gene:Prosalpha2 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001102354.1 Gene:Psma8 RGDID:1311659 Length:250 Species:Rattus norvegicus

Alignment Length:229 Identity:95/230 (41%)
Similarity:143/230 (62%) Gaps:11/230 (5%)


  Fly     5 RYSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRVEMIY 69
            ||..::|.|||.|.|.|:|||..||..|:.:|||..:|.||:..|.|..:.|.::.:|.::..:.
  Rat     4 RYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGVEKKSVAKLQDERTVRKICALD 68

  Fly    70 NHIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVSL 134
            :|:.|.::|:..|.|:::.:||...|::.||.::|:.|..:.:.:|||.|:||||.|.||||:|.
  Rat    69 DHVCMAFAGLTADARVVISRARVECQSHKLTVEDPVTVEYITRFIATLKQKYTQSNGRRPFGISA 133

  Fly   135 LICGWDNDR-PYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDD--AVHTAILTLK 196
            ||.|:|:|. |.|||:||||.|.||||.|:|::|...:.||||.|:||...:|  |:..||..|.
  Rat   134 LIVGFDDDGIPRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTEDAISNDNEAIKLAIKALL 198

  Fly   197 EGFE--GKMTADNIEIGICDQNGFQRLDPASIKD 228
            |..:  ||    |||:.|..::  |.|...|.|:
  Rat   199 EVVQSGGK----NIELAIIRRD--QPLKMFSAKE 226

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 PRK03996 6..233 CDD:235192 94/229 (41%)
proteasome_alpha_type_2 6..231 CDD:239719 94/229 (41%)
Psma8NP_001102354.1 PRK03996 5..234 CDD:235192 94/229 (41%)
proteasome_alpha_type_7 5..213 CDD:239724 90/212 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.