DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prosalpha2 and Prosbeta4

Sequence 1:NP_524328.1 Gene:Prosalpha2 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001260511.1 Gene:Prosbeta4 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster

Alignment Length:209 Identity:36/210 (17%)
Similarity:86/210 (41%) Gaps:37/210 (18%)


  Fly    36 VGIIASNGVVIATENKHKSPLY----EQHSVHRV--EMIYNHIGMVYSGMGPDYRLLVKQ---AR 91
            :||...:.|::|.:..|...:.    :|:.:|:|  .::.:.:|  .||....:...:.:   ..
  Fly     5 LGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVG--ESGDTEQFTEFISKNIALY 67

  Fly    92 KIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVSLLICGWDNDRPYLYQSDPSGAYF 156
            |:...|.|:.:|....::      ..:.||.:|.  .|:.|.:.:.|:|.:      :.|...:.
  Fly    68 KMRNGYDLSPRESAHFTR------KNLAEYLRSR--TPYQVFMFVAGYDPN------AGPELTFI 118

  Fly   157 AWKATAM-------GKNAVNGKTFLEKRYSEDL---ELDDAVHTAILTLKEGFEGKMTADNIEIG 211
            .:.|.|:       |..|:...:..::.:..::   |..|.....|..:::..  .:...|..:.
  Fly   119 DYLANALPVNYAGHGYGAIFASSIYDRYWHPNITQAEAYDVFKKCIAEIQKRL--VVNLKNFTVA 181

  Fly   212 ICDQNGFQRLDPAS 225
            :.|::|.:.|:|.|
  Fly   182 VVDKDGVRDLEPIS 195

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha2NP_524328.1 PRK03996 6..233 CDD:235192 36/210 (17%)
proteasome_alpha_type_2 6..231 CDD:239719 36/210 (17%)
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 35/207 (17%)
proteasome_beta_type_2 1..192 CDD:239727 34/205 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C79032222
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11599
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.